C17orf49 (NM_001142799) Human Recombinant Protein

BAP18 protein,

Product Info Summary

SKU: PROTQ8IXM2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C17orf49 (NM_001142799) Human Recombinant Protein

View all BAP18 recombinant proteins

SKU/Catalog Number

PROTQ8IXM2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 17 open reading frame 49 (C17orf49), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

C17orf49 (NM_001142799) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IXM2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.9kDa

Amino Acid Sequence

MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAQIKATVKRKVYEDSGIPLPAESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQA

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For BAP18 (Source: Uniprot.org, NCBI)

Gene Name

BAP18

Full Name

Chromatin complexes subunit BAP18

Weight

17.9kDa

Alternative Names

Chromatin complexes subunit BAP18

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BAP18, check out the BAP18 Infographic

BAP18 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BAP18: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8IXM2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C17orf49 (NM_001142799) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C17orf49 (NM_001142799) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C17orf49 (NM_001142799) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8IXM2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.