C1orf174 (NM_207356) Human Recombinant Protein

C1orf174 protein,

Recombinant protein of human chromosome 1 open reading frame 174 (C1orf174)

Product Info Summary

SKU: PROTQ8IYL3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C1orf174 (NM_207356) Human Recombinant Protein

View all C1orf174 recombinant proteins

SKU/Catalog Number

PROTQ8IYL3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 1 open reading frame 174 (C1orf174)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

C1orf174 (NM_207356) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IYL3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.977kDa

Amino Acid Sequence

MRSRKLTGAVRSSARLKARSCSAARLASAQEVAGSTSAKTACLTSSSHKATDRRTSKKFKCDKGHLVKSELQKLVPKNDSASLPKVTPETPCENEFAEGSALLPGSEAGVSVQQGAASLPLGGCRVVSDSRLAKTRDGLSVPKHSAGSGAEESNSSSTVQKQNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVSRFFGNVELMQDLPPASSSCPSMSRREFRKMHFRAKDDDDDDDDDAEM

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For C1orf174 (Source: Uniprot.org, NCBI)

Gene Name

C1orf174

Full Name

UPF0688 protein C1orf174

Weight

25.977kDa

Superfamily

UPF0688 family

Alternative Names

chromosome 1 open reading frame 174; RP13-531C17.2 C1orf174 chromosome 1 open reading frame 174 UPF0688 protein C1orf174|RP13-531C17.2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on C1orf174, check out the C1orf174 Infographic

C1orf174 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for C1orf174: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8IYL3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C1orf174 (NM_207356) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review C1orf174 (NM_207356) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C1orf174 (NM_207356) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8IYL3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.