Click image to see more details
Product Info Summary
| SKU: | PROTP08176 |
|---|---|
| Size: | 100ug, 500ug, 1mg |
| Source: | Escherichia coli |
Product info
Product Name
Der-P1 Der P1 Protein Recombinant Protein
SKU/Catalog Number
PROTP08176
Size
100ug, 500ug, 1mg
Description
The E. coli derived recombinant protein contains the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (a.a. 20-320) and fused to a 6 His Tag at C-terminus, having a total Mw of 34.5kDa, pI 5.6.
Storage & Handling
Der-P1 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Cite This Product
Der-P1 Der P1 Protein Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP08176)
Formulation
60mM NaCl and 50mM Tris-HCl pH 8.0.
Purity
Protein is greater than 95% pure as determined by 10% SDS-PAGE (coomassie staining).
Amino Acid Sequence
MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPY VVILHHHHHH
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Specific Publications For Der-P1 Der P1 Protein Recombinant Protein (PROTP08176)
Hello CJ!
No publications found for PROTP08176
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Der-P1 Der P1 Protein Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Der-P1 Der P1 Protein Recombinant Protein
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
