Histone H2A Bbd (H2AFB1) (NM_001017990) Human Recombinant Protein

H2AB1 protein,

Recombinant protein of human H2A histone family, member B1 (H2AFB1)

Product Info Summary

SKU: PROTP0C5Y9
Size: 20 µg
Source: HEK293T

Product Name

Histone H2A Bbd (H2AFB1) (NM_001017990) Human Recombinant Protein

View all H2AB1 recombinant proteins

SKU/Catalog Number

PROTP0C5Y9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human H2A histone family, member B1 (H2AFB1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

Histone H2A Bbd (H2AFB1) (NM_001017990) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP0C5Y9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.697kDa

Amino Acid Sequence

MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For H2AB1 (Source: Uniprot.org, NCBI)

Gene Name

H2AB1

Full Name

Histone H2A-Bbd type 1

Weight

12.697kDa

Superfamily

histone H2A family

Alternative Names

Histone H2A-Bbd type 1 H2AB1 H2A.B, H2A.Bbd, H2AFB1 H2A.B variant histone 1 histone H2A-Bbd type 1|H2A Barr body-deficient|H2A histone family member B1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on H2AB1, check out the H2AB1 Infographic

H2AB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for H2AB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP0C5Y9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Histone H2A Bbd (H2AFB1) (NM_001017990) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Histone H2A Bbd (H2AFB1) (NM_001017990) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Histone H2A Bbd (H2AFB1) (NM_001017990) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP0C5Y9
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.