Boster offers high affinity primary antibodies both monoclonal and polyclonal. Boster's primary antibodies are well cited over the past 20+ years have continue to be trusted by the research community. You can find here antibodies thoroughly validated on Western Blotting, Immunohistochemistry and ELISA. You can also find antibodies made from recombinant proteins and polypeptides representing specific epitope of the antigen. In case you have trouble finding or decided the right antibody for you, feel free to contact us at support@bosterbio.com or use the live chat function at the bottom right of the website.
Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:E. coli-derived human CYP27A1 recombinant protein (Position: R51-C531).
Clonality:Polyclonal
Application:ELISA, IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Mouse, Rat
Immunogen:E. coli-derived mouse Thioredoxin TRX recombinant protein (Position: V2-A105).
Clonality:Polyclonal
Application:ELISA, IHC-P, ICC, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:E. coli-derived human Glutathione Reductase recombinant protein (Position: K256-R522).
Clonality:Polyclonal
Application:ELISA, Flow Cytometry, IHC, IHC-P, ICC, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Mouse, Rat
Immunogen:E. coli-derived rat ANP recombinant protein (Position: N25-R122).
Clonality:Polyclonal
Application:ELISA, IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthetic peptide corresponding to a sequence of human NSE (LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENK).
Clonality:Polyclonal
Application:IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μl/vial
Validated Species:African green monkey, Human, Mouse, Rat
Immunogen:This antibody is produced by immunizing mouse with synthetic peptide ESNMNDLVSEYQQYQDATAC, coupled to KLH.
Clonality:Monoclonal
Clone Number:SGT13
Application:IP, IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:E. coli-derived human beta Catenin recombinant protein (Position: A2-K233).
Clonality:Monoclonal
Clone Number:1F6
Application:Flow Cytometry, IHC-P, ICC, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:A synthetic peptide corresponding to a sequence of human Talin 1 (QQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQ).
Clonality:Polyclonal
Application:IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Mouse, Rat
Immunogen:E. coli-derived mouse Hsp27 recombinant protein (Position: M1-K209).
Clonality:Polyclonal
Application:ELISA, IHC-P, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Monkey, Mouse
Immunogen:E. coli-derived human Calpain 2 recombinant protein (Position: R500-L700). Human Calpain 2 shares 93.5% and 92.5% amino acid (aa) sequence identity with mouse and rat Calpain 2, respectively.
Clonality:Monoclonal
Clone Number:8I6
Application:Flow Cytometry, IHC-P, WB

Availability: Ships in 5-7 business days

Page 1 of 14
items
  1. 1
  2. 2
  3. 3
  4. ...
  5. 14