Click image to see more details
Product Info Summary
| SKU: | PROTQ9R0C2 |
|---|---|
| Size: | 10ug, 50ug, 1mg |
| Origin Species: | Rat |
| Source: | Escherichia coli |
Product info
Product Name
Tpc1808 Tropic 1808 Rat Recombinant Protein
SKU/Catalog Number
PROTQ9R0C2
Size
10ug, 50ug, 1mg
Description
Tropic-1808 Rat Recombinant protein fused to N-terminal His-Tag produced in E. coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a molecular mass of 29.1 kDa. The Tpc1808 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C.Please prevent freeze-thaw cycles.
Cite This Product
Tpc1808 Tropic 1808 Rat Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9R0C2)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Purity
Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Amino Acid Sequence
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPS AGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKL TIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLS LNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLS AAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNF NLYLIKVKNTWKLMTLLLS
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Specific Publications For Tpc1808 Tropic 1808 Rat Recombinant Protein (PROTQ9R0C2)
Hello CJ!
No publications found for PROTQ9R0C2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Tpc1808 Tropic 1808 Rat Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Tpc1808 Tropic 1808 Rat Recombinant Protein
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
