TSC21 (TEX37) (NM_152670) Human Recombinant Protein

TSC21 protein,

Recombinant protein of human chromosome 2 open reading frame 51 (C2orf51)

Product Info Summary

SKU: PROTQ96LM6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TSC21 (TEX37) (NM_152670) Human Recombinant Protein

View all TSC21 recombinant proteins

SKU/Catalog Number

PROTQ96LM6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 2 open reading frame 51 (C2orf51)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

TSC21 (TEX37) (NM_152670) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96LM6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.041kDa

Amino Acid Sequence

MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQ

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For Tex37 (Source: Uniprot.org, NCBI)

Gene Name

Tex37

Full Name

Testis-expressed sequence 37 protein

Weight

21.041kDa

Alternative Names

chromosome 2 open reading frame 51; FLJ25369; protein TSC21; Testis-specific conserved protein of 21 kDa; TSC21

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Tex37, check out the Tex37 Infographic

Tex37 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Tex37: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96LM6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TSC21 (TEX37) (NM_152670) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review TSC21 (TEX37) (NM_152670) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TSC21 (TEX37) (NM_152670) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96LM6
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.