Click image to see more details
Product Info Summary
| SKU: | PROTP0AA25 |
|---|---|
| Size: | 20ug, 100ug, 1mg |
| Source: | Escherichia coli |
Product info
Product Name
TXN1 Thioredoxin E.Coli Recombinant Protein
SKU/Catalog Number
PROTP0AA25
Size
20ug, 100ug, 1mg
Description
Recombinant Thioredoxin was purified from E. coli harboring its gene.
Storage & Handling
TRX although stable at 4°C for 3 weeks, should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
Cite This Product
TXN1 Thioredoxin E.Coli Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP0AA25)
Form
Sterile Lyophilized Powder.
Formulation
Each mg of protein contains 20mM phosphate buffer pH 7.4.
Purity
Greater than 90.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Reconstitution
It is recommended to reconstitute the lyophilized TRX in sterile 18MΩ-cm H2O.
Amino Acid Sequence
HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA
Biological Activity
TRX activity is assayed by measuring the change in absorbance at 650 nm at 25°C using 0.13µM bovine insulin containing 0.33mM DTT (pH 6.5).
The specific activity was found to be 3IU/mg.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized TRX in sterile 18MΩ-cm H2O.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Specific Publications For TXN1 Thioredoxin E.Coli Recombinant Protein (PROTP0AA25)
Hello CJ!
No publications found for PROTP0AA25
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used TXN1 Thioredoxin E.Coli Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review TXN1 Thioredoxin E.Coli Recombinant Protein
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
