Anti-ADAM2 Antibody Picoband™

ADAM2 antibody

Boster Bio Anti-ADAM2 Antibody Picoband™ catalog # A08379-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A08379-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-ADAM2 Antibody Picoband™

View all ADAM2 Antibodies

SKU/Catalog Number



100 μg/vial




Boster Bio Anti-ADAM2 Antibody Picoband™ catalog # A08379-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ADAM2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A08379-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




Rabbit IgG


A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A08379-1 is reactive to ADAM2 in Human, Mouse, Rat


A08379-1 is guaranteed for WB Boster Guarantee

Background of ADAM2

ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For ADAM2 (Source:, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Disintegrin and metalloproteinase domain-containing protein 2



Alternative Names

ADAM metallopeptidase domain 2; Cancer/testis antigen 15; CRYN2; CT15ADAM 2; disintegrin and metalloproteinase domain-containing protein 2; EC 3.4.24; fertilin beta; Fertilin subunit beta; FTNBCRYN1; PH-30; PH-30b; PH30PH30-beta ADAM2 CRYN1, CRYN2, CT15, FTNB, PH-30b, PH30, PH30-beta ADAM metallopeptidase domain 2 disintegrin and metalloproteinase domain-containing protein 2|cancer/testis antigen 15|fertilin subunit beta

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ADAM2, check out the ADAM2 Infographic

ADAM2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ADAM2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for A08379-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ADAM2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-ADAM2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-ADAM2 Antibody Picoband™


Does anti-ADAM2 antibody A08379-1 work for WB with testis?

Verified Customer

Verified customer

Asked: 2020-03-04


According to the expression profile of testis, ADAM2 is highly expressed in testis. So, it is likely that anti-ADAM2 antibody A08379-1 will work for WB with testis.

Boster Scientific Support

Answered: 2020-03-04


I see that the anti-ADAM2 antibody A08379-1 works with WB, what is the protocol used to produce the result images on the product page?

K. Carter

Verified customer

Asked: 2019-11-26


You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-11-26


We need to test anti-ADAM2 antibody A08379-1 on rat testis for research purposes, then I may be interested in using anti-ADAM2 antibody A08379-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

S. Huang

Verified customer

Asked: 2019-07-04


The products we sell, including anti-ADAM2 antibody A08379-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-07-04


Is a blocking peptide available for product anti-ADAM2 antibody (A08379-1)?

Verified Customer

Verified customer

Asked: 2018-11-29


We do provide the blocking peptide for product anti-ADAM2 antibody (A08379-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-11-29


Will anti-ADAM2 antibody A08379-1 work on horse WB with testis?

Verified Customer

Verified customer

Asked: 2018-11-06


Our lab technicians have not tested anti-ADAM2 antibody A08379-1 on horse. You can run a BLAST between horse and the immunogen sequence of anti-ADAM2 antibody A08379-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse testis in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-11-06


Do you have a BSA free version of anti-ADAM2 antibody A08379-1 available?

V. Kulkarni

Verified customer

Asked: 2013-12-17


We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-ADAM2 antibody A08379-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2013-12-17



Total: $315


Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.