Anti-ALDH2 Antibody Picoband™(monoclonal, 6H2)

ALDH2 antibody

Boster Bio Anti-ALDH2 Antibody Picoband™ (monoclonal, 6H2) catalog # M00546-2. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: M00546-2
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Mouse
Application: Flow Cytometry, IF, ICC, WB

Product Name

Anti-ALDH2 Antibody Picoband™(monoclonal, 6H2)

View all ALDH2 Antibodies

SKU/Catalog Number







Boster Bio Anti-ALDH2 Antibody Picoband™ (monoclonal, 6H2) catalog # M00546-2. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ALDH2 Antibody Picoband™(monoclonal, 6H2) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00546-2)




Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.



Clone Number





A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Reactive Species

M00546-2 is reactive to ALDH2 in Human, Mouse, Rat


M00546-2 is guaranteed for Flow Cytometry, IF, ICC, WB Boster Guarantee

Background of ALDH2

ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500μg/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5 μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 2 μg/ml, Human
Flow Cytometry, 1-3 μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For ALDH2 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Aldehyde dehydrogenase, mitochondrial




aldehyde dehydrogenase family

Alternative Names

acetaldehyde dehydrogenase 2; aldehyde dehydrogenase 2 family (mitochondrial); aldehyde dehydrogenase, mitochondrial; ALDH class 2; ALDH2; ALDH-E2; ALDHI; ALDM; EC 1.2.1; EC; liver mitochondrial ALDH; MGC1806; nucleus-encoded mitochondrial aldehyde dehydrogenase 2 ALDH2 ALDH-E2, ALDHI, ALDM aldehyde dehydrogenase 2 family member aldehyde dehydrogenase, mitochondrial|ALDH class 2|acetaldehyde dehydrogenase 2|aldehyde dehydrogenase 2 family (mitochondrial)|epididymis secretory sperm binding protein|liver mitochondrial ALDH|nucleus-encoded mitochondrial aldehyde dehydrogenase 2

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ALDH2, check out the ALDH2 Infographic

ALDH2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ALDH2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for M00546-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ALDH2 Antibody Picoband™(monoclonal, 6H2)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-ALDH2 Antibody Picoband™(monoclonal, 6H2)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-ALDH2 Antibody Picoband™(monoclonal, 6H2)



how to order through PO

Total: $315



Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.