Product Info Summary
SKU: | M00546-2 |
---|---|
Size: | 100μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Mouse |
Application: | Flow Cytometry, IF, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ALDH2 Antibody Picoband™(monoclonal, 6H2)
SKU/Catalog Number
M00546-2
Size
100μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ALDH2 Antibody Picoband™ (monoclonal, 6H2) catalog # M00546-2. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ALDH2 Antibody Picoband™(monoclonal, 6H2) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00546-2)
Host
Mouse
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
Clonality
Monoclonal
Clone Number
6H2
Isotype
IgG1
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Reactive Species
M00546-2 is reactive to ALDH2 in Human, Mouse, Rat
Applications
M00546-2 is guaranteed for Flow Cytometry, IF, ICC, WB Boster Guarantee
Background of ALDH2
ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5 μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 2 μg/ml, Human
Flow Cytometry, 1-3 μg/1x106 cells, Human
Validation Images & Assay Conditions

Click image to see more details
Figure 1. Western blot analysis of ALDH2 using anti-ALDH2 antibody (M00546-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human HepG2 whole cell lysates,
Lane 2: human placenta tissue lysates,
Lane 3: human HEK293 whole cell lysates,
Lane 4: human HL-60 whole cell lysates,
Lane 5: human SHG-44 whole cell lysates,
Lane 6: human THP-1 whole cell lysates,
Lane 7: human K562 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-ALDH2 antigen affinity purified monoclonal antibody (Catalog # M00546-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1001) with Tanon 5200 system. A specific band was detected for ALDH2 at approximately 56 kDa. The expected band size for ALDH2 is at 56 kDa.

Click image to see more details
Figure 2. Western blot analysis of ALDH2 using anti-ALDH2 antibody (M00546-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat liver tissue lysates,
Lane 2: rat kidney tissue lysates,
Lane 3: rat heart tissue lysates,
Lane 4: rat PC-12 whole cell lysates,
Lane 5: mouse liver tissue lysates,
Lane 6: mouse Ana-1 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-ALDH2 antigen affinity purified monoclonal antibody (Catalog # M00546-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1001) with Tanon 5200 system. A specific band was detected for ALDH2 at approximately 56 kDa. The expected band size for ALDH2 is at 56 kDa.

Click image to see more details
Figure 3. IF analysis of ALDH2 using anti-ALDH2 antibody (M00546-2).
ALDH2 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2 μg/mL mouse anti-ALDH2 Antibody (M00546-2) overnight at 4°C. DyLight488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

Click image to see more details
Figure 4. IF analysis of ALDH2 using anti-ALDH2 antibody (M00546-2).
ALDH2 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2 μg/mL mouse anti-ALDH2 Antibody (M00546-2) overnight at 4°C. DyLight488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

Click image to see more details
Figure 5. Flow Cytometry analysis of SiHa cells using anti-ALDH2 antibody (M00546-2). Overlay histogram showing SiHa cells stained with M00546-2 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-ALDH2 Antibody (M00546-2,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For ALDH2 (Source: Uniprot.Org, NCBI)
Uniprot ID
P05091
Gene ID
217
Gene Name
ALDH2
Full Name
Aldehyde dehydrogenase, mitochondrial
Weight
56.381kDa
Superfamily
aldehyde dehydrogenase family
Alternative Names
acetaldehyde dehydrogenase 2; aldehyde dehydrogenase 2 family (mitochondrial); aldehyde dehydrogenase, mitochondrial; ALDH class 2; ALDH2; ALDH-E2; ALDHI; ALDM; EC 1.2.1; EC 1.2.1.3; liver mitochondrial ALDH; MGC1806; nucleus-encoded mitochondrial aldehyde dehydrogenase 2 ALDH2 ALDH-E2, ALDHI, ALDM aldehyde dehydrogenase 2 family member aldehyde dehydrogenase, mitochondrial|ALDH class 2|acetaldehyde dehydrogenase 2|aldehyde dehydrogenase 2 family (mitochondrial)|epididymis secretory sperm binding protein|liver mitochondrial ALDH|nucleus-encoded mitochondrial aldehyde dehydrogenase 2
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".For more info on ALDH2, check out the ALDH2 Infographic

We have 30,000+ of these available, one for each gene! check them out.
In this infographic you will see the following information for ALDH2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]
Specific Publications For Anti-ALDH2 Antibody Picoband™(monoclonal, 6H2) (M00546-2)
No publications found for M00546-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ALDH2 Antibody Picoband™(monoclonal, 6H2)?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-ALDH2 Antibody Picoband™(monoclonal, 6H2)
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question