Anti-Annexin IV/ANXA4 Antibody Picoband™

Boster Bio Anti-Annexin IV/ANXA4 Antibody Picoband™ catalog # A04840. Tested in IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: A04840
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC-P, WB

Product Name

Anti-Annexin IV/ANXA4 Antibody Picoband™

See all Annexin A4 products

SKU/Catalog Number







Boster Bio Anti-Annexin IV/ANXA4 Antibody Picoband™ catalog # A04840. Tested in IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Annexin IV/ANXA4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04840)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL), different from the related mouse and rat sequences by three amino acids.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A04840 is reactive to ANXA4 in Human, Mouse, Rat


A04840 is guaranteed for IHC-P, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat

Validation Images & Assay Conditions

Gene/Protein Information For ANXA4 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Annexin A4




annexin family

Alternative Names

AIV; Annexin A4; annexin IV (placental anticoagulant protein II); Annexin IV; annexin-4; ANX4; ANX4Carbohydrate-binding protein p33/p41; ANXA4; Chromobindin-4; chromobindin-4,35-beta calcimedin; DKFZp686H02120; Endonexin I; Lipocortin IV; MGC75105; P32.5; PAP-II; PIG28; Placental anticoagulant protein II; PP4-X; proliferation-inducing gene 28; proliferation-inducing protein 28; Protein II; ZAP36 ANXA4 ANX4, HEL-S-274, P32.5, PAP-II, PIG28, PP4-X, ZAP36 annexin A4 annexin A4|35-beta calcimedin|annexin IV (placental anticoagulant protein II)|annexin-4|carbohydrate-binding protein p33/p41|chromobindin-4|endonexin I|epididymis secretory protein Li 274|lipocortin IV|placental anticoagulant protein II|proliferation-inducing gene 28|proliferation-inducing protein 28|protein II

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ANXA4, check out the ANXA4 Infographic

ANXA4 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ANXA4: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A04840 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Annexin A1, A2, A4 and A5 play important roles in breast cancer, pancreatic cancer and laryngeal carcinoma, alone and/or synergistically

Have you used Anti-Annexin IV/ANXA4 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Annexin IV/ANXA4 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-Annexin IV/ANXA4 Antibody Picoband™


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.