Product Info Summary
SKU: | A01946-1 |
---|---|
Size: | 100μl |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-DNA pol beta Antibody
View all DNA Polymerase beta Antibodies
SKU/Catalog Number
A01946-1
Size
100μl
Form
Liquid
Description
Boster Bio Anti-DNA pol beta Antibody catalog # A01946-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-DNA pol beta Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01946-1)
Host
Rabbit
Contents
Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.
Clonality
Polyclonal
Isotype
IgG
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A1 Synthetic peptide LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross reactivity with other proteins.
Reactive Species
A01946-1 is reactive to POLB in Human, Mouse, Rat
Reconstitution
Restore with deionized water (or equivalent) for reconstitution volume of 100 µL
Observed Molecular Weight
39 kDa
Calculated molecular weight
38178 MW
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01946-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
WB, 1:500-1:2000
Positive Control
Validation Images & Assay Conditions
![a01946 1 western blotting analysis 2 a01946 1 western blotting analysis 2](https://www.bosterbio.com/media/catalog/product/a/0/a01946-1-western-blotting-analysis-2.jpg)
Click image to see more details
Western Blot (WB) analysis of K562 cells using DNA pol beta Polyclonal antibody.
![a01946 1 western blotting analysis 1 a01946 1 western blotting analysis 1](https://www.bosterbio.com/media/catalog/product/a/0/a01946-1-western-blotting-analysis-1.jpg)
Click image to see more details
Western Blot (WB) analysis of specific cells using DNA pol beta Polyclonal antibody.
Protein Target Info & Infographic
Gene/Protein Information For POLB (Source: Uniprot.org, NCBI)
Gene Name
POLB
Full Name
DNA polymerase beta
Weight
38178 MW
Superfamily
DNA polymerase type-X family
Alternative Names
DNA pol beta; DNA polymerase beta subunit; DNA Polymerase beta; EC 2.7.7.7; EC 4.2.99.-; MGC125976; POLB; polymerase (DNA directed), beta POLB DNA polymerase beta DNA polymerase beta|DNA pol beta|DNA polymerase beta subunit|polymerase (DNA directed), beta|polymerase (DNA) beta
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on POLB, check out the POLB Infographic
![POLB infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for POLB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-DNA pol beta Antibody (A01946-1)
Hello CJ!
No publications found for A01946-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-DNA pol beta Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-DNA pol beta Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question