Anti-EWSR1 Antibody Picoband™

Boster Bio Anti-EWSR1 Antibody Picoband™ catalog # PB9585. Tested in Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9585
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB

Product Name

Anti-EWSR1 Antibody Picoband™

See all EWSR1 products

SKU/Catalog Number







Boster Bio Anti-EWSR1 Antibody Picoband™ catalog # PB9585. Tested in Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-EWSR1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9585)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9585 is reactive to EWSR1 in Human, Mouse, Rat


PB9585 is guaranteed for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For EWSR1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

RNA-binding protein EWS




RRM TET family

Alternative Names

bK984G1.4; Ewing sarcoma breakpoint region 1 protein; Ewing sarcoma breakpoint region 1; Ewings sarcoma EWS-Fli1 (type 1) oncogene; EWS oncogene; EWSRNA-binding protein EWS EWSR1 EWS, EWS-FLI1, bK984G1.4 EWS RNA binding protein 1 RNA-binding protein EWS|EWS RNA-binding protein variant 6|Ewing sarcoma breakpoint region 1|Ewings sarcoma EWS-Fli1 (type 1) oncogene

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on EWSR1, check out the EWSR1 Infographic

EWSR1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for EWSR1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9585

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-EWSR1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-EWSR1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-EWSR1 Antibody Picoband™


Has PB9585 antibody been tested on mouse samples with Western Blot, Immunocytochemistry and Immunofluorescence applications?

Verified customer

Asked: 2019-09-19


The Anti-EWSR1 Antibody Picoband PB9585 was tested on mouse samples with WB only. Our lab hasn't worked on mouse samples with Immunocytochemistry and Immunofluorescence applications due to sample limitation. It is suggested to run pilot tests for this.

Boster Scientific Support

Answered: 2019-09-20


I was wanting to use your anti-EWSR1 antibody for Flow Cytometry for rat testis on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat testis identification?

Verified Customer

Verified customer

Asked: 2019-09-18


You can see on the product datasheet, PB9585 anti-EWSR1 antibody has been tested for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat testis in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-09-18


We are currently using anti-EWSR1 antibody PB9585 for rat tissue, and we are satisfied with the IHC-F results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on zebrafish tissues as well?

B. Jones

Verified customer

Asked: 2018-10-09


The anti-EWSR1 antibody (PB9585) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-10-09


See below the WB image, lot number and protocol we used for testis using anti-EWSR1 antibody PB9585. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2017-11-27


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-11-27


Do you have a BSA free version of anti-EWSR1 antibody PB9585 available?

S. Carter

Verified customer

Asked: 2016-09-26


Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-EWSR1 antibody PB9585 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2016-09-26


how to order through PO


Total: $280

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.