Anti-GRP78 BiP/HSPA5 Antibody Picoband®

HSPA5 antibody

Boster Bio Anti-GRP78 BiP/HSPA5 Antibody Picoband® catalog # PB9640. Tested in ICC/IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 8 publication(s). Independently reviewed in 1 review(s).

Product Info Summary

SKU: PB9640
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC, ICC, WB
Designing a Western blot for HSPA5? The guide covers the expected band size, antibodies backed by real blot images, the controls to run alongside, and protocols taken from published papers.
Open the HSPA5 Western Blot Guide

Customers Who Bought This Also Bought

Product Name

Anti-GRP78 BiP/HSPA5 Antibody Picoband®

View all HSPA5 Antibodies

SKU/Catalog Number

PB9640
PB0669 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-GRP78 BiP/HSPA5 Antibody Picoband® catalog # PB9640. Tested in ICC/IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-GRP78 BiP/HSPA5 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9640)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9640 is reactive to HSPA5 in Human, Mouse, Rat

Observed Molecular Weight

78 kDa

Calculated molecular weight

72.3 kDa

Background of HSPA5

HSPA5 (heat shock 70kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9640 is guaranteed for IF, IHC, ICC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section)2-5μg/mlHuman, Mouse, Rat
Immunocytochemistry/Immunofluorescence5 μg/mlHuman

Tested application

GRP78 antibody was positively detected by WB in:
human U251 whole cell, human HepG2 whole cell, human K562 whole cell, human A431 whole cell, rat testis tissue, rat liver tissue, mouse testis tissue, mouse liver tissue
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
GRP78 antibody was positively detected by IHC in:
human cerebral cortex tissue, mouse testis tissue, rat testis tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
GRP78 antibody was positively detected by ICC/IF in:
Hela cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-GRP78 BiP/HSPA5 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

1 Reviews For Anti-GRP78 BiP/HSPA5 Antibody Picoband®

Accurate localization and good imaging quality

Excellent

SKU PB9640
Application Immunofluorenscence
Sample Mouse 4T1 cell climbing slides
Sample Processing Description Mouse 4T1 cells fixed with 4% paraformaldehyde for 15 minutes
Primary Antibody Anti-GRP78 antibody
Primary Incubation 1:400, overnight at 4 ℃
Blocking Agent Goat serum
Secondary Antibody DyLight 550-conjugated goat anti-rabbit antibody.
Secondary Incubation Incubate at room temperature for 1 hour
Detection Laser confocal microscopy
Results Summary The ordering and delivery cycle of the antibodies is short — I was able to receive the products within a week, which saved a lot of time. The pre-sales and after-sales services are convenient and efficient. Since my background is in chemistry, I consulted Boster’s technical staff about many details of biological experiments. The technical specialists were patient and helpful in their analysis and explanations, which allowed me to avoid many detours during the actual experimental procedures. Most importantly, these antibodies offer a high cost-performance ratio, with good binding performance, excellent imaging results, and a high experimental success rate, providing a solid foundation for conducting related experiments.

Verified customer

Submitted

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-GRP78 BiP/HSPA5 Antibody Picoband®

Question

My lab would like to test anti-GRP78 BiP/HSPA5 antibody PB9640 on mouse mammary carcinoma for research purposes, then I may be interested in using anti-GRP78 BiP/HSPA5 antibody PB9640 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-04-28

Answer

The products we sell, including anti-GRP78 BiP/HSPA5 antibody PB9640, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-04-28

Question

Is this PB9640 anti-GRP78 BiP/HSPA5 antibody reactive to the isotypes of HSPA5?

Verified Customer

Verified customer

Asked: 2020-04-10

Answer

The immunogen of PB9640 anti-GRP78 BiP/HSPA5 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP (592-624aa ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-10

Question

My question regarding product PB9640, anti-GRP78 BiP/HSPA5 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-02-11

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9640 anti-GRP78 BiP/HSPA5 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-02-11

Question

Is a blocking peptide available for product anti-GRP78 BiP/HSPA5 antibody (PB9640)?

R. Gonzalez

Verified customer

Asked: 2019-12-11

Answer

We do provide the blocking peptide for product anti-GRP78 BiP/HSPA5 antibody (PB9640). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2019-12-11

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for mammary carcinoma using anti-GRP78 BiP/HSPA5 antibody PB9640. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-11-25

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-25

Question

Will PB9640 anti-GRP78 BiP/HSPA5 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-07-23

Answer

It shows on the product datasheet, PB9640 anti-GRP78 BiP/HSPA5 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-07-23

Question

Is there a BSA free version of anti-GRP78 BiP/HSPA5 antibody PB9640 available?

Verified Customer

Verified customer

Asked: 2019-07-15

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-GRP78 BiP/HSPA5 antibody PB9640 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-07-15

Question

We were well pleased with the WB result of your anti-GRP78 BiP/HSPA5 antibody. However we have observed positive staining in colon carcinoma endoplasmic reticulum lumen using this antibody. Is that expected? Could you tell me where is HSPA5 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-06-26

Answer

From literature, colon carcinoma does express HSPA5. Generally HSPA5 expresses in endoplasmic reticulum lumen. Regarding which tissues have HSPA5 expression, here are a few articles citing expression in various tissues:
Articular cartilage, Pubmed ID: 11160188
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 1550958
Cervix carcinoma, Pubmed ID: 20068231
Colon carcinoma, Pubmed ID: 9150948, 24129315
Fibroblast, Pubmed ID: 15164053
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 9150946
Melanoma, Pubmed ID: 12643545, 17081065
Muscle, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-06-26

Question

We have been able to see staining in human melanoma. Are there any suggestions? Is anti-GRP78 BiP/HSPA5 antibody supposed to stain melanoma positively?

Verified Customer

Verified customer

Asked: 2018-09-21

Answer

From literature melanoma does express HSPA5. From Uniprot.org, HSPA5 is expressed in vena cava, cervix carcinoma, fibroblast, muscle, articular cartilage, mammary carcinoma, colon carcinoma, brain, cajal-retzius cell fetal brain cortex, melanoma, liver, among other tissues. Regarding which tissues have HSPA5 expression, here are a few articles citing expression in various tissues:
Articular cartilage, Pubmed ID: 11160188
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 1550958
Cervix carcinoma, Pubmed ID: 20068231
Colon carcinoma, Pubmed ID: 9150948, 24129315
Fibroblast, Pubmed ID: 15164053
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 9150946
Melanoma, Pubmed ID: 12643545, 17081065
Muscle, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2018-09-21

Question

I am looking for using your anti-GRP78 BiP/HSPA5 antibody for ire1alpha activates chaperones studies. Has this antibody been tested with western blotting on testis tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2018-07-12

Answer

I appreciate your inquiry. This PB9640 anti-GRP78 BiP/HSPA5 antibody is validated on hela whole cell lysate, mouse brain, testis tissue, brain tissue, rat testis tissue, lung cancer tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-07-12

Question

I have attached the WB image, lot number and protocol we used for mammary carcinoma using anti-GRP78 BiP/HSPA5 antibody PB9640. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-05-30

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-05-30

Question

We are currently using anti-GRP78 BiP/HSPA5 antibody PB9640 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2017-09-07

Answer

The anti-GRP78 BiP/HSPA5 antibody (PB9640) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-09-07

Question

We ordered your anti-GRP78 BiP/HSPA5 antibody for IHC on melanoma in the past. I am using rat, and We are going to use the antibody for WB next. I am interested in examining melanoma as well as cajal-retzius cell fetal brain cortex in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

K. Krishna

Verified customer

Asked: 2015-06-03

Answer

I took a look at the website and datasheets of our anti-GRP78 BiP/HSPA5 antibody and it seems that PB9640 has been tested on rat in both IHC and WB. Thus PB9640 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2015-06-03

Question

I was wanting to use your anti-GRP78 BiP/HSPA5 antibody for WB for mouse mammary carcinoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse mammary carcinoma identification?

J. Moore

Verified customer

Asked: 2015-05-04

Answer

It shows on the product datasheet, PB9640 anti-GRP78 BiP/HSPA5 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse mammary carcinoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2015-05-04

Question

I see that the anti-GRP78 BiP/HSPA5 antibody PB9640 works with WB, what is the protocol used to produce the result images on the product page?

P. Huang

Verified customer

Asked: 2014-04-09

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2014-04-09

Question

Does anti-GRP78 BiP/HSPA5 antibody PB9640 work for WB with mammary carcinoma?

V. Lewis

Verified customer

Asked: 2013-09-13

Answer

According to the expression profile of mammary carcinoma, HSPA5 is highly expressed in mammary carcinoma. So, it is likely that anti-GRP78 BiP/HSPA5 antibody PB9640 will work for WB with mammary carcinoma.

Boster Scientific Support

Answered: 2013-09-13

Order DetailsPrice
PB9640

100μg

$370
PB9640-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9640-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9640-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9640-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9640-APC

100 μg APC conjugated (liquid)

$820
PB9640-FITC

100 μg FITC conjugated (liquid)

$570
PB9640-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9640-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9640-HRP

100 μg HRP conjugated (liquid)

$570
PB9640-PE

100 μg PE conjugated (liquid)

$820
PB9640-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9640
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 11, 2026