Product Info Summary
| SKU: | PB9669 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-MMP9 Antibody Picoband®
SKU/Catalog Number
PB9669
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-MMP9 Antibody Picoband® catalog # PB9669. Tested in IHC, WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-MMP9 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9669)
Host
Rabbit
Contents
Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP-9, different from the related human sequence by thirteen amino acids, and from the related rat sequence by eight amino acids.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9669 is reactive to Mmp9 in Mouse, Rat
Observed Molecular Weight
78 kDa
Calculated molecular weight
80.5 kDa
Background of Mmp9
Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9669 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat
ELISA , 0.1-0.5μg/ml, Mouse, -
Western blot, 0.1-0.5μg/ml, Mouse, Rat
Positive Control
WB: NRK Whole Cell, ANA-1 Whole Cell, HEPA Whole Cell
IHC: mouse kidney tissue, rat liver tissue
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of MMP-9 using anti-MMP-9 antibody (PB9669).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 40 ug of sample under reducing conditions.
Lane 1: NRK Whole Cell Lysate,
Lane 2: ANA-1 Whole Cell Lysate,
Lane 3: HEPA Whole Cell Lysate.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MMP-9 antigen affinity purified polyclonal antibody (Catalog # PB9669) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for MMP-9 at approximately 78 kDa. The expected band size for MMP-9 is at 78 kDa.
Click image to see more details
IHC analysis of MMP-9 using anti-MMP-9 antibody (PB9669).
MMP-9 was detected in a paraffin-embedded section of mouse kidney tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-MMP-9 Antibody (PB9669) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Effects of JTG on expression of associated proteins and NF-κB pathway of osteoclast induced from BMMs with RANKL and LPS. BMMs were incubated with RANKL and JTG for 48 h, the proteins were extracted to analyze associated proteins of osteoclast by Western blot. A : a Western blot imagines for expression of NFATc1, c-Fos, Cathepsin K and MMP9. A : b – e The quantification analysis of NFATc1, c-Fos, Cathepsin K and MMP9 based on the results of A : a by ECL detection system, respectively. B : a The images of Western blot for TRAF6, P-P65, P65 and IκBα. B : b – d The quantification analysis of TRAF6, P-P65/P65 and IκBα based on the results of B : a by using an ECL detection system, respectively. Each point represents the mean ± SD (n = 3). The experiments were repeated for three times. * P < 0.05, ** P < 0.01 compared with control group
Index in PubMed under a CC BY license. PMID: 36195960
Click image to see more details
Effect of JFS on invasion and metastasis. (A–C) The mRNA levels of MMP-2, MMP-9, and TIMP-1 were detected by qPCR in different groups. (D–G) The protein levels of MMP-2, MMP-9, and TIMP-1 were detected by western blotting, and the ratio of MMP-2, MMP-9, and TIMP-1 with β-actin were shown. # P < 0.05 to control, ## P < 0.01 to control, ∗ P < 0.05 to EMS, ∗∗ P < 0.01 to EMS. Columns, mean ( n = 3). Bars, SD. EMS, endometriosis; JFS, Jiawei Foshou San .
Index in PubMed under a CC BY license. PMID: 30093862
Click image to see more details
IHC analysis of MMP-9 using anti-MMP-9 antibody (PB9669).
MMP-9 was detected in a paraffin-embedded section of rat liver tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-MMP-9 Antibody (PB9669) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Specific Publications For Anti-MMP9 Antibody Picoband® (PB9669)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-MMP9 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-MMP9 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-MMP9 Antibody Picoband®
Question
Is there a BSA free version of anti-MMP9 antibody PB9669 available?
Verified Customer
Verified customer
Asked: 2020-05-07
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-MMP9 antibody PB9669 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-05-07
Question
I am interested in using your anti-MMP9 antibody for positive regulation of dna binding studies. Has this antibody been tested with western blotting on nrk whole cell lysate? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2020-04-13
Answer
Thank you for your inquiry. This PB9669 anti-MMP9 antibody is tested on nrk whole cell lysate, hepa whole cell lysate, mouse kidney tissue, rat liver tissue. It is guaranteed to work for IHC, WB in mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2020-04-13
Question
We have observed staining in mouse umbilical cord blood. Are there any suggestions? Is anti-MMP9 antibody supposed to stain umbilical cord blood positively?
Verified Customer
Verified customer
Asked: 2020-03-27
Answer
From what I have seen in literature umbilical cord blood does express MMP9. From what I have seen in Uniprot.org, MMP9 is expressed in tibia, umbilical cord blood, b-cell, neutrophil, fibrosarcoma, blood, monocytic leukemia, among other tissues. Regarding which tissues have MMP9 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Blood, Pubmed ID: 1480034, 1281792
Fibrosarcoma, Pubmed ID: 1400481, 7669817
Monocytic leukemia, Pubmed ID: 20800577
Neutrophil, Pubmed ID: 1645657, 1464361, 1653055
Umbilical cord blood, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-03-27
Question
I see that the anti-MMP9 antibody PB9669 works with WB, what is the protocol used to produce the result images on the product page?
P. Patel
Verified customer
Asked: 2019-11-25
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2019-11-25
Question
Here is the WB image, lot number and protocol we used for neutrophil using anti-MMP9 antibody PB9669. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-09-17
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-09-17
Question
Would PB9669 anti-MMP9 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
N. Johnson
Verified customer
Asked: 2019-09-16
Answer
You can see on the product datasheet, PB9669 anti-MMP9 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-09-16
Question
My boss were happy with the WB result of your anti-MMP9 antibody. However we have been able to see positive staining in fibrosarcoma extracellular using this antibody. Is that expected? Could you tell me where is MMP9 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-08-23
Answer
According to literature, fibrosarcoma does express MMP9. Generally MMP9 expresses in secreted, extracellular space, extracellular. Regarding which tissues have MMP9 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Blood, Pubmed ID: 1480034, 1281792
Fibrosarcoma, Pubmed ID: 1400481, 7669817
Monocytic leukemia, Pubmed ID: 20800577
Neutrophil, Pubmed ID: 1645657, 1464361, 1653055
Umbilical cord blood, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-08-23
Question
Will anti-MMP9 antibody PB9669 work for WB with neutrophil?
Verified Customer
Verified customer
Asked: 2019-07-23
Answer
According to the expression profile of neutrophil, MMP9 is highly expressed in neutrophil. So, it is likely that anti-MMP9 antibody PB9669 will work for WB with neutrophil.
Boster Scientific Support
Answered: 2019-07-23
Question
My question regarding product PB9669, anti-MMP9 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-05-27
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9669 anti-MMP9 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-05-27
Question
We purchased anti-MMP9 antibody for WB on fibrosarcoma a few months ago. I am using rat, and We are going to use the antibody for IHC next. you antibody examining fibrosarcoma as well as tibia in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?
Verified Customer
Verified customer
Asked: 2018-09-20
Answer
I took a look at the website and datasheets of our anti-MMP9 antibody and it seems that PB9669 has been validated on rat in both WB and IHC. Thus PB9669 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2018-09-20
Question
We are currently using anti-MMP9 antibody PB9669 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it true that the antibody can work on pig tissues as well?
A. Parker
Verified customer
Asked: 2018-05-22
Answer
The anti-MMP9 antibody (PB9669) has not been validated for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-05-22
Question
Is a blocking peptide available for product anti-MMP9 antibody (PB9669)?
Verified Customer
Verified customer
Asked: 2017-11-21
Answer
We do provide the blocking peptide for product anti-MMP9 antibody (PB9669). If you would like to place an order for it please contact support@bosterbio.com and make a special request.
Boster Scientific Support
Answered: 2017-11-21
Question
Is this PB9669 anti-MMP9 antibody reactive to the isotypes of MMP9?
E. Wu
Verified customer
Asked: 2017-02-16
Answer
The immunogen of PB9669 anti-MMP9 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP-9 (641-672aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF), different from the related human sequence by thirteen amino acids, and from the related rat sequence by eight amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-02-16
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for neutrophil using anti-MMP9 antibody PB9669. Let me know if you need anything else.
M. Wu
Verified customer
Asked: 2016-01-29
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-01-29
Question
I am interested in to test anti-MMP9 antibody PB9669 on rat neutrophil for research purposes, then I may be interested in using anti-MMP9 antibody PB9669 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
M. Walker
Verified customer
Asked: 2015-12-24
Answer
The products we sell, including anti-MMP9 antibody PB9669, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2015-12-24
Question
I was wanting to use your anti-MMP9 antibody for WB for rat neutrophil on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat neutrophil identification?
L. Evans
Verified customer
Asked: 2013-11-07
Answer
It shows on the product datasheet, PB9669 anti-MMP9 antibody has been validated for IHC, WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat neutrophil in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2013-11-07


