Anti-RAB13 Antibody Picoband™

RAB13 antibody

Boster Bio Anti-RAB13 Antibody Picoband™ catalog # PB9790. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: PB9790
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IF, ICC, WB

Product Name

Anti-RAB13 Antibody Picoband™

View all RAB13 Antibodies

SKU/Catalog Number

PB9790

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-RAB13 Antibody Picoband™ catalog # PB9790. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-RAB13 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9790)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human RAB13 (121-150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET), different from the related mouse and rat sequences by four amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9790 is reactive to RAB13 in Human

Applications

PB9790 is guaranteed for Flow Cytometry, IF, ICC, WB Boster Guarantee

Background of RAB13

Ras-related protein Rab-13 is a protein that in humans is encoded by the RAB13 gene. This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.25-0.5μg/ml, Human
Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human
Flow Cytometry, 1-3 μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For RAB13 (Source: Uniprot.org, NCBI)

Uniprot ID

P51153

Gene ID

5872

Gene Name

RAB13

Full Name

Ras-related protein Rab-13

Weight

22.774kDa

Superfamily

small GTPase superfamily

Alternative Names

Cell growth-inhibiting gene 4 protein; growth-inhibiting gene 4 protein; Rab13; RAB13, member RAS oncogene family; RAS-associated protein RAB13; ras-related protein Rab-13 RAB13 GIG4 RAB13, member RAS oncogene family ras-related protein Rab-13|RAS-associated protein RAB13|cell growth-inhibiting gene 4 protein|growth-inhibiting gene 4 protein

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on RAB13, check out the RAB13 Infographic

RAB13 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAB13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for PB9790

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-RAB13 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-RAB13 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-RAB13 Antibody Picoband™

Question

We are currently using anti-RAB13 antibody PB9790 for rat tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2019-01-01

Answer

The anti-RAB13 antibody (PB9790) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-01-01

Size

Conjugation

Total: $315

SKU:PB9790

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9790
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.