Anti-RAGE/AGER Antibody Picoband™

AGER antibody

Boster Bio Anti-RAGE/AGER Antibody Picoband™ catalog # PB9469. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 7 publication(s).

Product Info Summary

SKU: PB9469
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-RAGE/AGER Antibody Picoband™

View all AGER Antibodies

SKU/Catalog Number

PB9469

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-RAGE/AGER Antibody Picoband™ catalog # PB9469. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-RAGE/AGER Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9469)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE, different from the related mouse and rat sequences by six amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9469 is reactive to AGER in Human, Mouse, Rat

Applications

PB9469 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

45-58 kDa

Calculated molecular weight

42.803kDa

Background of AGER

The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Rat

Validation Images & Assay Conditions

Gene/Protein Information For AGER (Source: Uniprot.org, NCBI)

Gene Name

AGER

Full Name

Advanced glycosylation end product-specific receptor

Weight

42.803kDa

Alternative Names

advanced glycosylation end product-specific receptor; AGER; RAGE isoform delta; RAGE isoform sRAGE-delta; RAGE; Receptor for advanced glycosylation end products; receptor for advanced glycosylation end-products; SCARJ1 AGER RAGE, SCARJ1, sRAGE advanced glycosylation end-product specific receptor advanced glycosylation end product-specific receptor|receptor for advanced glycation end-products variant 20

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on AGER, check out the AGER Infographic

AGER infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AGER: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9469 has been cited in 7 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Ethyl pyruvate attenuated coxsackievirus B3-induced acute viral myocarditis by suppression of HMGB1/RAGE/NF-?B pathway

Li JY, Lu YH, Zhang LW, Zhou PM, Chen T. Ann Dermatol. 2017 Feb;29(1):121-123. doi: 10.5021/ad.2017.29.1.121. Epub 2017 Feb 3. Increased Serum High Mobility Group Box 1 (HMGB1) Concentration and the Altered Expression of HMGB1 and Its Receptor Adv...

Wang F, He Q, Wang J, Yuan Q, Guo H, Chai L, Wang S, Hu L, Zhang Y. BMC Complement Altern Med. 2017 May 10;17(1):258. doi: 10.1186/s12906-017-1738-8. Neuroprotective effect of salvianolate lyophilized injection against cerebral ischemia in type 1 ...

Qin Q, Niu J, Wang Z, Xu W, Qiao Z, Gu Y. Cardiovasc Diabetol. 2013 Feb 26;12:37. Doi: 10.1186/1475-2840-12-37. Heparanase Induced By Advanced Glycation End Products (Ages) Promotes Macrophage Migration Involving Rage And Pi3K/Akt Pathway.

Liu J, Wang S, Feng L, Ma D, Fu Q, Song Y, Jia X, Ma S. J Med Food. 2013 Jul;16(7):577-86. Doi: 10.1089/Jmf.2012.2654. Hypoglycemic And Antioxidant Activities Of Paeonol And Its Beneficial Effect On Diabetic Encephalopathy In Streptozotocin-Induce...

Wang L, Zhang X, Liu L, Yang R, Cui L, Li M. Neurosci Lett. 2010 Mar 8;471(3):152-6. Doi: 10.1016/J.Neulet.2010.01.030. Epub 2010 Jan 25. Atorvastatin Protects Rat Brains Against Permanent Focal Ischemia And Downregulates Hmgb1, Hmgb1 Receptors (R...

Wang L, Zhang X, Liu L, Cui L, Yang R, Li M, Du W. Brain Res. 2010 Mar 19;1321:143-51. Doi: 10.1016/J.Brainres.2009.12.046. Epub 2010 Jan 4. Tanshinone Ii A Down-Regulates Hmgb1, Rage, Tlr4, Nf-Kappab Expression, Ameliorates Bbb Permeability And E...

Have you used Anti-RAGE/AGER Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-RAGE/AGER Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-RAGE/AGER Antibody Picoband™

Question

I see that the anti-RAGE/AGER antibody PB9469 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-04-02

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-04-02

Question

I am interested in to test anti-RAGE/AGER antibody PB9469 on rat aortic smooth muscle lung for research purposes, then I may be interested in using anti-RAGE/AGER antibody PB9469 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-01-15

Answer

The products we sell, including anti-RAGE/AGER antibody PB9469, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-01-15

Question

Is this PB9469 anti-RAGE/AGER antibody reactive to the isotypes of AGER?

Verified Customer

Verified customer

Asked: 2019-11-08

Answer

The immunogen of PB9469 anti-RAGE/AGER antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-11-08

Question

I was wanting to use your anti-RAGE/AGER antibody for IHC for rat aortic smooth muscle lung on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat aortic smooth muscle lung identification?

Verified Customer

Verified customer

Asked: 2019-08-29

Answer

You can see on the product datasheet, PB9469 anti-RAGE/AGER antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat aortic smooth muscle lung in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-08-29

Question

Would anti-RAGE/AGER antibody PB9469 work on pig IHC with aortic smooth muscle lung?

Verified Customer

Verified customer

Asked: 2018-01-19

Answer

Our lab technicians have not tested anti-RAGE/AGER antibody PB9469 on pig. You can run a BLAST between pig and the immunogen sequence of anti-RAGE/AGER antibody PB9469 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig aortic smooth muscle lung in IHC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-01-19

Question

We are currently using anti-RAGE/AGER antibody PB9469 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on bovine tissues as well?

C. Miller

Verified customer

Asked: 2017-07-18

Answer

The anti-RAGE/AGER antibody (PB9469) has not been validated for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-07-18

Question

Is a blocking peptide available for product anti-RAGE/AGER antibody (PB9469)?

A. Bhatt

Verified customer

Asked: 2014-09-09

Answer

We do provide the blocking peptide for product anti-RAGE/AGER antibody (PB9469). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2014-09-09

Size

Conjugation

Total: $370

SKU:PB9469

In stock, 3+ left.

Order within 0 hours and 43 minutes to receive by Wed Mar 20

Get A Quote
Eddy test
In stock
Order Product
PB9469
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.