Anti-SRI Antibody Picoband™

Boster Bio Anti-SRI Antibody Picoband™ catalog # A00222. Tested in Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00222
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB

Product Name

Anti-SRI Antibody Picoband™

See all SR1 products

SKU/Catalog Number

A00222

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SRI Antibody Picoband™ catalog # A00222. Tested in Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SRI Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00222)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00222 is reactive to SRI in Human, Mouse, Rat

Applications

A00222 is guaranteed for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For SRI (Source: Uniprot.Org, NCBI)

Uniprot ID

P30626

Gene ID

6717

Gene Name

SRI

Full Name

Sorcin

Weight

21.676kDa

Alternative Names

calcium binding protein amplified in mutlidrug-resistant cells; CP22; CP-22; FLJ26259,22 kDa protein; H_RG167B05.1; SCN; sorcin; V19 SRI CP-22, CP22, SCN, V19 sorcin sorcin|22 kDa protein|H_RG167B05.1|calcium binding protein amplified in mutlidrug-resistant cells

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on SRI, check out the SRI Infographic

SRI infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for SRI: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00222

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SRI Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-SRI Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-SRI Antibody Picoband™

Question

Is a blocking peptide available for product anti-SRI antibody (A00222)?

Verified Customer

Verified customer

Asked: 2019-11-28

Answer

We do provide the blocking peptide for product anti-SRI antibody (A00222). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-11-28

Question

I see that the anti-SRI antibody A00222 works with IHC-P, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-08-23

Answer

You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-08-23

Question

Please see the WB image, lot number and protocol we used for brain using anti-SRI antibody A00222. Please let me know if you require anything else.

C. Banerjee

Verified customer

Asked: 2019-04-15

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-04-15

Question

Is this A00222 anti-SRI antibody reactive to the isotypes of SRI?

S. Li

Verified customer

Asked: 2016-06-06

Answer

The immunogen of A00222 anti-SRI antibody is A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-06-06

Conjugation

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A00222
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.