Anti-SRI Antibody Picoband™

SR1 antibody

Boster Bio Anti-SRI Antibody Picoband™ catalog # A00222. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00222
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, IHC-F, ICC, WB

Product Name

Anti-SRI Antibody Picoband™

View all SR1 Antibodies

SKU/Catalog Number







Boster Bio Anti-SRI Antibody Picoband™ catalog # A00222. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SRI Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00222)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00222 is reactive to SRI in Human, Mouse, Rat


A00222 is guaranteed for Flow Cytometry, IF, IHC, IHC-F, ICC, WB Boster Guarantee

Background of SR1

Sorcin is a protein that in humans is encoded by the SRI gene. It is mapped to 7q21.1. This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene. 

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For SRI (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name




Alternative Names

calcium binding protein amplified in mutlidrug-resistant cells; CP22; CP-22; FLJ26259,22 kDa protein; H_RG167B05.1; SCN; sorcin; V19 SRI CP-22, CP22, SCN, V19 sorcin sorcin|22 kDa protein|H_RG167B05.1|calcium binding protein amplified in mutlidrug-resistant cells

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on SRI, check out the SRI Infographic

SRI infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for SRI: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00222

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SRI Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-SRI Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-SRI Antibody Picoband™


Is a blocking peptide available for product anti-SRI antibody (A00222)?

Verified Customer

Verified customer

Asked: 2019-11-28


We do provide the blocking peptide for product anti-SRI antibody (A00222). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-11-28


I see that the anti-SRI antibody A00222 works with IHC-P, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-08-23


You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-08-23


Please see the WB image, lot number and protocol we used for brain using anti-SRI antibody A00222. Please let me know if you require anything else.

C. Banerjee

Verified customer

Asked: 2019-04-15


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-04-15


Is this A00222 anti-SRI antibody reactive to the isotypes of SRI?

S. Li

Verified customer

Asked: 2016-06-06


The immunogen of A00222 anti-SRI antibody is A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-06-06


how to order through PO


Total: $315



Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.