ATP5F1D (NM_001001975) Human Recombinant Protein

ATP5F1D protein,

Product Info Summary

SKU: PROTP30049
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ATP5F1D (NM_001001975) Human Recombinant Protein

View all ATP5F1D recombinant proteins

SKU/Catalog Number

PROTP30049

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (ATP5D), nuclear gene encoding mitochondrial protein, transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ATP5F1D (NM_001001975) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP30049)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.49kDa

Amino Acid Sequence

MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For ATP5F1D (Source: Uniprot.org, NCBI)

Gene Name

ATP5F1D

Full Name

ATP synthase subunit delta, mitochondrial

Weight

17.49kDa

Superfamily

ATPase epsilon chain family

Alternative Names

ATP synthase subunit delta, mitochondrial ATP5F1D ATP5D, MC5DN5 ATP synthase F1 subunit delta ATP synthase subunit delta, mitochondrial|ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit|F-ATPase delta subunit|mitochondrial ATP synthase complex delta-subunit precusor|mitochondrial ATP synthase, delta subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ATP5F1D, check out the ATP5F1D Infographic

ATP5F1D infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ATP5F1D: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP30049

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ATP5F1D (NM_001001975) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review ATP5F1D (NM_001001975) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ATP5F1D (NM_001001975) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP30049
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.