Click image to see more details
Product Info Summary
| SKU: | PROTQ8CJ70 |
|---|---|
| Size: | 2ug, 10ug, 1mg |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
IL-19 Interleukin-19 Mouse Recombinant Protein
View all IL-19 recombinant proteins
SKU/Catalog Number
PROTQ8CJ70
Size
2ug, 10ug, 1mg
Description
Interleukin-19 Mouse Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
IL-19 Interleukin-19 Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8CJ70)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a sterile filtered aqueous solution containing 5mM Na3PO4 and 150mM NaCl, pH 7.5.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Predicted MW
20.452kDa
Reconstitution
It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLL TFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRII HDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For IL19 (Source: Uniprot.org, NCBI)
Gene Name
IL19
Full Name
Interleukin-19
Weight
20.452kDa
Superfamily
IL-10 family
Alternative Names
IL-10C; IL19; IL-19; interleukin 19; MDA1; melanoma differentiation associated protein-like protein; NG.1Melanoma differentiation-associated protein-like protein; ZMDA1interleukin-19 IL19 IL-10C, MDA1, NG.1, ZMDA1 interleukin 19 interleukin-19|melanoma differentiation associated protein-like protein
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL19, check out the IL19 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL19: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For IL-19 Interleukin-19 Mouse Recombinant Protein (PROTQ8CJ70)
Hello CJ!
No publications found for PROTQ8CJ70
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used IL-19 Interleukin-19 Mouse Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review IL-19 Interleukin-19 Mouse Recombinant Protein
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
