Boster offers high affinity primary antibodies both monoclonal and polyclonal. Boster's primary antibodies are well cited over the past 20+ years have continue to be trusted by the research community. You can find here antibodies thoroughly validated on Western Blotting, Immunohistochemistry and ELISA. You can also find antibodies made from recombinant proteins and polypeptides representing specific epitope of the antigen. In case you have trouble finding or decided the right antibody for you, feel free to contact us at support@bosterbio.com or use the live chat function at the bottom right of the website.
Pack Size:100μg/vial
Validated Species:Mouse
Immunogen:A synthetic peptide corresponding to a sequence in the middle region of mouse Leptin (74-109aa KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH), different from the related human sequence by five amino acids, and from the related rat sequence by two amino acids.
Predicted Species:Chicken
Clonality:Polyclonal
Application:ELISA, WB

Availability: Ships in 5-7 business days

Pack Size:50μg/vial
Validated Species:Canine
Immunogen:Recombinant canine IL-21
Clonality:Polyclonal
Application:ELISA

Availability: Ships in 5-7 business days

Pack Size:100ug/vial
Validated Species:Human, Mouse, Rat
Immunogen:E. coli-derived human NFAT2 recombinant protein (Position: Q589-K652).
Clonality:Polyclonal
Application:ELISA, Flow Cytometry, IHC, ICC, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human
Immunogen:E. coli-derived human CD72 recombinant protein (Position: R117-D359).
Clonality:Polyclonal
Application:ELISA, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:E. coli-derived human PLAU recombinant protein (Position: I179-L431).
Clonality:Polyclonal
Application:ELISA, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Rabbit
Immunogen:Recombinant rabbit IL-8
Clonality:Polyclonal
Application:ELISA, WB

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Mouse, Rat
Immunogen:E. coli-derived mouse Nucleobindin 2 recombinant protein (Position: V25-L106). Mouse Nucleobindin 2 shares 85.4% and 97.6% amino acid (aa) sequence identity with human and rat Nucleobindin 2, respectively.
Clonality:Polyclonal
Application:ELISA, IHC, WB
Availability: Ships next business day
Pack Size:50μg/vial
Validated Species:Bovine
Immunogen:Recombinant bovine LIF
Clonality:Polyclonal
Application:ELISA

Availability: Ships in 5-7 business days

Pack Size:100ug/vial
Validated Species:Human
Immunogen:E. coli-derived huamn TREM1 recombinant protein (Position: A21-R200).
Clonality:Polyclonal
Application:ELISA

Availability: Ships in 5-7 business days

Pack Size:100μg/vial
Validated Species:Human, Mouse, Rat
Immunogen:E. coli-derived human Nova1 recombinant protein (Position: T416-V509).
Clonality:Polyclonal
Application:ELISA, IHC-P, WB

Availability: Ships in 5-7 business days

Page 1 of 106
items
  1. 1
  2. 2
  3. 3
  4. ...
  5. 106