S100A5 (NM_002962) Human Recombinant Protein

S100A5 protein,

Product Info Summary

SKU: PROTP33763
Size: 20 µg
Source: HEK293T

Product Name

S100A5 (NM_002962) Human Recombinant Protein

View all S100A5 recombinant proteins

SKU/Catalog Number

PROTP33763

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human S100 calcium binding protein A5 (S100A5)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

S100A5 (NM_002962) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP33763)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.744kDa

Amino Acid Sequence

MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For S100A5 (Source: Uniprot.org, NCBI)

Gene Name

S100A5

Full Name

Protein S100-A5

Weight

10.744kDa

Superfamily

S-100 family

Alternative Names

Protein S-100D; S100 calcium binding protein A5; S100 calcium-binding protein A5S100Dprotein S100-A5 S100A5 S100D S100 calcium binding protein A5 protein S100-A5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on S100A5, check out the S100A5 Infographic

S100A5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for S100A5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP33763

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used S100A5 (NM_002962) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review S100A5 (NM_002962) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for S100A5 (NM_002962) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP33763
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.