SAP30BP (NM_013260) Human Recombinant Protein

SAP30BP protein,

Recombinant protein of human SAP30 binding protein (SAP30BP)

Product Info Summary

SKU: PROTQ9UHR5
Size: 20 µg
Source: HEK293T

Product Name

SAP30BP (NM_013260) Human Recombinant Protein

View all SAP30BP recombinant proteins

SKU/Catalog Number

PROTQ9UHR5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SAP30 binding protein (SAP30BP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

SAP30BP (NM_013260) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UHR5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.87kDa

Amino Acid Sequence

MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For SAP30BP (Source: Uniprot.org, NCBI)

Gene Name

SAP30BP

Full Name

SAP30-binding protein

Weight

33.87kDa

Superfamily

HCNGP family

Alternative Names

HCNGPDKFZp586L2022; HTRGHSV-1 binding; HTRPSAP30-binding protein; SAP30 binding protein; Transcriptional regulator protein HCNGP SAP30BP HCNGP, HTRG, HTRP SAP30 binding protein SAP30-binding protein|HSV-1 binding|transcriptional regulator protein HCNGP

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SAP30BP, check out the SAP30BP Infographic

SAP30BP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SAP30BP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UHR5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SAP30BP (NM_013260) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review SAP30BP (NM_013260) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SAP30BP (NM_013260) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UHR5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.