TIMM8A (NM_004085) Human Recombinant Protein

TIMM8A protein,

Product Info Summary

SKU: PROTO60220
Size: 20 µg
Source: HEK293T

Product Name

TIMM8A (NM_004085) Human Recombinant Protein

View all TIMM8A recombinant proteins

SKU/Catalog Number

PROTO60220

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human translocase of inner mitochondrial membrane 8 homolog A (yeast) (TIMM8A), nuclear gene encoding mitochondrial protein, transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

TIMM8A (NM_004085) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60220)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.998kDa

Amino Acid Sequence

MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For TIMM8A (Source: Uniprot.org, NCBI)

Gene Name

TIMM8A

Full Name

Mitochondrial import inner membrane translocase subunit Tim8 A

Weight

10.998kDa

Superfamily

small Tim family

Alternative Names

DDP1deafness/dystonia peptide; DDPMGC12262; Deafness dystonia protein 1; DFN1; mitochondrial import inner membrane translocase subunit Tim8 A; MTSTIM8; TIM8A; translocase of inner mitochondrial membrane 8 (yeast) homolog A; translocase of inner mitochondrial membrane 8 homolog A (yeast); X-linked deafness dystonia protein TIMM8A DDP, DDP1, DFN1, MTS, TIM8 translocase of inner mitochondrial membrane 8A mitochondrial import inner membrane translocase subunit Tim8 A|X-linked deafness dystonia protein|deafness dystonia protein 1|deafness/dystonia peptide|translocase of inner mitochondrial membrane 8 homolog A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TIMM8A, check out the TIMM8A Infographic

TIMM8A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TIMM8A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60220

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TIMM8A (NM_004085) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review TIMM8A (NM_004085) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TIMM8A (NM_004085) Human Recombinant Protein

$1249
In stock, 1 left.

Order within 101 hours and 12 minutes to receive by Tue May 21

Get A Quote
In stock
Order Product
PROTO60220
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.