Amylin (IAPP) (NM_000415) Human Recombinant Protein

Amylin protein,

Recombinant protein of human islet amyloid polypeptide (IAPP)

Product Info Summary

SKU: PROTP10997
Size: 20 µg
Source: HEK293T

Product Name

Amylin (IAPP) (NM_000415) Human Recombinant Protein

View all Amylin recombinant proteins

SKU/Catalog Number

PROTP10997

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human islet amyloid polypeptide (IAPP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

Amylin (IAPP) (NM_000415) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP10997)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.806kDa

Amino Acid Sequence

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For IAPP (Source: Uniprot.org, NCBI)

Gene Name

IAPP

Full Name

Islet amyloid polypeptide

Weight

9.806kDa

Superfamily

calcitonin family

Alternative Names

AMYLIN; DAPamylin; Diabetes-associated peptide; IAP; Insulinoma amyloid peptide; Islet amyloid polypeptide (diabetes-associated peptide; amylin); islet amyloid polypeptide IAPP DAP, IAP islet amyloid polypeptide islet amyloid polypeptide|Islet amyloid polypeptide (diabetes-associated peptide; amylin)|amylin|diabetes-associated peptide|insulinoma amyloid peptide

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IAPP, check out the IAPP Infographic

IAPP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IAPP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP10997

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Amylin (IAPP) (NM_000415) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Amylin (IAPP) (NM_000415) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Amylin (IAPP) (NM_000415) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP10997
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.