Product Info Summary
SKU: | A00101-1 |
---|---|
Size: | 100ug/vial |
Reactive Species: | Mouse |
Host: | Rabbit |
Application: | ELISA, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-IL1 beta/Il1b Antibody Picoband™
View all IL-1 beta/IL-1F2 Antibodies
SKU/Catalog Number
A00101-1
Size
100ug/vial
Form
Lyophilized
Description
Boster Bio Anti-IL1 beta/Il1b Antibody Picoband™ catalog # A00101-1. Tested in ELISA, WB applications. This antibody reacts with Mouse.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-IL1 beta/Il1b Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00101-1)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Immunogen
E.coli-derived mouse IL-1 beta/Il1b recombinant protein (Position: V118-S269).
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross Reactivity
No cross reactivity with other proteins.
Reactive Species
A00101-1 is reactive to Il1b in Mouse
Applications
A00101-1 is guaranteed for ELISA, WB Boster Guarantee
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.25μg/ml
Direct ELISA, 0.1-0.5 μg/ml
Validation Images & Assay Conditions

Click image to see more details
Figure 1. Western blot analysis of IL1 beta using anti-IL1 beta antibody (A00101-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: mouse spleen tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IL1 beta antigen affinity purified polyclonal antibody (Catalog # A00101-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for IL1 beta at approximately 31KD. The expected band size for IL1 beta is at 31KD.
Protein Target Info & Infographic
Gene/Protein Information For Il1b (Source: Uniprot.Org, NCBI)
Uniprot ID
P01584
Gene ID
3553
Gene Name
Il1b
Full Name
Interleukin-1 beta
Weight
30.748kDa
Superfamily
IL-1 family
Alternative Names
catabolin; IL1 beta; IL-1 beta; IL-1; IL1B; IL-1b; IL1-BETA; IL-1F2; IL1F2IL-1 beta; interleukin 1, beta; interleukin-1 beta; preinterleukin 1 beta; pro-interleukin-1-beta IL1B IL-1, IL1-BETA, IL1F2, IL1beta interleukin 1 beta interleukin-1 beta|IL-1 beta|catabolin|interleukin 1beta|preinterleukin 1 beta|pro-interleukin-1-beta
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".For more info on Il1b, check out the Il1b Infographic

We have 30,000+ of these available, one for each gene! check them out.
In this infographic you will see the following information for Il1b: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]
Specific Publications For Anti-IL1 beta/Il1b Antibody Picoband™ (A00101-1)
A00101-1 has been cited in 16 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Sophocarpine Alleviates Injury-Induced Intima Hyperplasia of Carotid Arteries by Suppressing Inflammation in a Rat Model
TREM2 ameliorates neuroinflammatory response and cognitive impairment via PI3K/AKT/FoxO3a signaling pathway in Alzheimer’s disease mice
Lycopene Ameliorates Atrazine-Induced Pyroptosis in Spleen via Suppressing the Ox-mtDNA/Nlrp3 Inflammasome Pathway
CD38 deficiency up-regulated IL-1β and MCP-1 through TLR4/ERK/NF-κB pathway in sepsis pulmonary injury
GABAB receptor activation attenuates inflammatory orofacial pain by modulating interleukin-1β in satellite glial cells: Role of NF-κB and MAPK signaling pathways
Liu F,Zhang YY,Song N,Lin J,Liu MK,Huang CL,Zhou C,Wang H,Wang M,Shen JF.GABAB receptor activation attenuates inflammatory orofacial pain by modulating interleukin-1β in satellite glial cells: Role of NF-κB and MAPK signaling pathways.Brain Res Bull.2019 Jul;149:240-250.doi:10.1016/j.brainresbull.2019.04.018.Epub 2019 Apr 26.PMID:31034945.
Species: Rat
A00101-1 usage in article: APP:WB, SAMPLE:SGCS, DILUTION:1:1000
Ghoneim ME,Abdallah DM,Shebl AM,El-Abhar HS. The interrupted cross-talk of inflammatory and oxidative stress trajectories signifies the effect of artesunate against hepatic ischemia/reperfusion-induced inflammasomopathy. Toxicol Appl Pharmacol.2020 Oct 29
Species: Rat
A00101-1 usage in article: APP:WB, SAMPLE:PROTEIN EXTRACTIONS OF LIVER TISSUES, DILUTION:1:300
Exogenous %u03B1-calcitonin gene-related peptide attenuates lipopolysaccharide-induced acute lung injury in rats
In vivo anti-inflammatory activity of caffeoylquinic acid derivatives from Solidago virgaurea in rats
Effects of extract of Buddleja officinalis on partial inflammation of lacrimal gland in castrated rabbits with dry eye
miR-181a Induces Macrophage Polarized to M2 Phenotype and Promotes M2 Macrophage-mediated Tumor Cell Metastasis by Targeting KLF6 and C/EBP?
Antenatal exposure of maternal secondhand smoke (SHS) increases fetal lung expression of RAGE and induces RAGE-mediated pulmonary inflammation
NLRP3 Inflammasome Sequential Changes in?Staphylococcus aureus-Induced Mouse Model of Acute Rhinosinusitis
Neuroprotective Effect of Kaempferol Glycosides against Brain Injury and Neuroinflammation by Inhibiting the Activation of NF-?B and STAT3 in Transient Focal Stroke
Li C, Chen X, Zhang N, Song Y, Mu Y. Neural Regen Res. 2012 Feb 15;7(5):325-31. Doi: 10.3969/J.Issn.1673-5374.2012.05.001. Gastrodin Inhibits Neuroinflammation In Rotenone-Induced Parkinson'S Disease Model Rats.
Li J, Zhao L, He X, Zeng Yj, Dai Ss. Plos One. 2013;8(3):E59257. Doi: 10.1371/Journal.Pone.0059257. Epub 2013 Mar 15. Sinomenine Protects Against Lipopolysaccharide-Induced Acute Lung Injury In Mice Via Adenosine A(2A) Receptor Signaling.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-IL1 beta/Il1b Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-IL1 beta/Il1b Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
14 Customer Q&As for Anti-IL1 beta/Il1b Antibody Picoband™
Question
Is a blocking peptide available for product anti-IL1 beta/Il1b antibody (A00101-1)?
Verified Customer
Verified customer
Asked: 2020-05-08
Answer
We do provide the blocking peptide for product anti-IL1 beta/Il1b antibody (A00101-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-05-08
Question
Is this A00101-1 anti-IL1 beta/Il1b antibody reactive to the isotypes of IL1B?
Verified Customer
Verified customer
Asked: 2020-03-02
Answer
The immunogen of A00101-1 anti-IL1 beta/Il1b antibody is A synthetic peptide corresponding to a sequence of mouse IL1 beta (DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-03-02
Question
We are currently using anti-IL1 beta/Il1b antibody A00101-1 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it possible that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2019-09-16
Answer
The anti-IL1 beta/Il1b antibody (A00101-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-09-16
Question
Can you help my question with product A00101-1, anti-IL1 beta/Il1b antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-07-15
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00101-1 anti-IL1 beta/Il1b antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-07-15
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for histiocytic lymphoma using anti-IL1 beta/Il1b antibody A00101-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-07-01
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-07-01
Question
I am interested in to test anti-IL1 beta/Il1b antibody A00101-1 on rat histiocytic lymphoma for research purposes, then I may be interested in using anti-IL1 beta/Il1b antibody A00101-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
L. Yang
Verified customer
Asked: 2019-03-29
Answer
The products we sell, including anti-IL1 beta/Il1b antibody A00101-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-03-29
Question
I was wanting to use your anti-IL1 beta/Il1b antibody for WB for rat histiocytic lymphoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat histiocytic lymphoma identification?
D. Johnson
Verified customer
Asked: 2017-11-03
Answer
As indicated on the product datasheet, A00101-1 anti-IL1 beta/Il1b antibody has been validated for WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat histiocytic lymphoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-11-03
Question
My team were satisfied with the WB result of your anti-IL1 beta/Il1b antibody. However we have been able to see positive staining in lung cytosol using this antibody. Is that expected? Could you tell me where is IL1B supposed to be expressed?
T. Walker
Verified customer
Asked: 2017-08-01
Answer
According to literature, lung does express IL1B. Generally IL1B expresses in cytoplasm, cytosol. Regarding which tissues have IL1B expression, here are a few articles citing expression in various tissues:
Histiocytic lymphoma, Pubmed ID: 3493774
Leukocyte, Pubmed ID: 3490654
Lung, Pubmed ID: 15489334
Macrophage, Pubmed ID: 20148899
Monocyte, Pubmed ID: 2635664, 11991722
Skin, Pubmed ID: 1919436
Boster Scientific Support
Answered: 2017-08-01
Question
Would anti-IL1 beta/Il1b antibody A00101-1 work for WB with histiocytic lymphoma?
G. Rodriguez
Verified customer
Asked: 2017-03-07
Answer
According to the expression profile of histiocytic lymphoma, IL1B is highly expressed in histiocytic lymphoma. So, it is likely that anti-IL1 beta/Il1b antibody A00101-1 will work for WB with histiocytic lymphoma.
Boster Scientific Support
Answered: 2017-03-07
Question
Would A00101-1 anti-IL1 beta/Il1b antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
A. Li
Verified customer
Asked: 2016-07-08
Answer
It shows on the product datasheet, A00101-1 anti-IL1 beta/Il1b antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2016-07-08
Question
We have seen staining in mouse monocyte. Any tips? Is anti-IL1 beta/Il1b antibody supposed to stain monocyte positively?
G. Kulkarni
Verified customer
Asked: 2014-09-15
Answer
From literature monocyte does express IL1B. From Uniprot.org, IL1B is expressed in smooth muscle tissue, leukocyte, histiocytic lymphoma, monocyte, lung, skin, macrophage, among other tissues. Regarding which tissues have IL1B expression, here are a few articles citing expression in various tissues:
Histiocytic lymphoma, Pubmed ID: 3493774
Leukocyte, Pubmed ID: 3490654
Lung, Pubmed ID: 15489334
Macrophage, Pubmed ID: 20148899
Monocyte, Pubmed ID: 2635664, 11991722
Skin, Pubmed ID: 1919436
Boster Scientific Support
Answered: 2014-09-15
Question
Do you have a BSA free version of anti-IL1 beta/Il1b antibody A00101-1 available?
S. Jones
Verified customer
Asked: 2014-09-09
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-IL1 beta/Il1b antibody A00101-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-09-09
Question
I see that the anti-IL1 beta/Il1b antibody A00101-1 works with WB, what is the protocol used to produce the result images on the product page?
D. Parker
Verified customer
Asked: 2013-06-10
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2013-06-10
Question
See below the WB image, lot number and protocol we used for histiocytic lymphoma using anti-IL1 beta/Il1b antibody A00101-1. Please let me know if you require anything else.
Z. Carter
Verified customer
Asked: 2013-02-12
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2013-02-12