Anti-IL1 beta/Il1b Antibody Picoband™

IL-1 beta/IL-1F2 antibody

Boster Bio Anti-IL1 beta/Il1b Antibody Picoband™ catalog # A00101-1. Tested in ELISA, WB applications. This antibody reacts with Mouse. Cited in 16 publication(s).

Product Info Summary

SKU: A00101-1
Size: 100ug/vial
Reactive Species: Mouse
Host: Rabbit
Application: ELISA, WB

Product Name

Anti-IL1 beta/Il1b Antibody Picoband™

View all IL-1 beta/IL-1F2 Antibodies

SKU/Catalog Number

A00101-1

Size

100ug/vial

Form

Lyophilized

Description

Boster Bio Anti-IL1 beta/Il1b Antibody Picoband™ catalog # A00101-1. Tested in ELISA, WB applications. This antibody reacts with Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-IL1 beta/Il1b Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00101-1)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Immunogen

E.coli-derived mouse IL-1 beta/Il1b recombinant protein (Position: V118-S269).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00101-1 is reactive to Il1b in Mouse

Applications

A00101-1 is guaranteed for ELISA, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.25μg/ml
Direct ELISA, 0.1-0.5 μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For Il1b (Source: Uniprot.Org, NCBI)

Uniprot ID

P01584

Gene ID

3553

Gene Name

Il1b

Full Name

Interleukin-1 beta

Weight

30.748kDa

Superfamily

IL-1 family

Alternative Names

catabolin; IL1 beta; IL-1 beta; IL-1; IL1B; IL-1b; IL1-BETA; IL-1F2; IL1F2IL-1 beta; interleukin 1, beta; interleukin-1 beta; preinterleukin 1 beta; pro-interleukin-1-beta IL1B IL-1, IL1-BETA, IL1F2, IL1beta interleukin 1 beta interleukin-1 beta|IL-1 beta|catabolin|interleukin 1beta|preinterleukin 1 beta|pro-interleukin-1-beta

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on Il1b, check out the Il1b Infographic

Il1b infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for Il1b: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A00101-1 has been cited in 16 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Sophocarpine Alleviates Injury-Induced Intima Hyperplasia of Carotid Arteries by Suppressing Inflammation in a Rat Model

TREM2 ameliorates neuroinflammatory response and cognitive impairment via PI3K/AKT/FoxO3a signaling pathway in Alzheimer’s disease mice

Lycopene Ameliorates Atrazine-Induced Pyroptosis in Spleen via Suppressing the Ox-mtDNA/Nlrp3 Inflammasome Pathway

CD38 deficiency up-regulated IL-1β and MCP-1 through TLR4/ERK/NF-κB pathway in sepsis pulmonary injury

GABAB receptor activation attenuates inflammatory orofacial pain by modulating interleukin-1β in satellite glial cells: Role of NF-κB and MAPK signaling pathways

Liu F,Zhang YY,Song N,Lin J,Liu MK,Huang CL,Zhou C,Wang H,Wang M,Shen JF.GABAB receptor activation attenuates inflammatory orofacial pain by modulating interleukin-1β in satellite glial cells: Role of NF-κB and MAPK signaling pathways.Brain Res Bull.2019 Jul;149:240-250.doi:10.1016/j.brainresbull.2019.04.018.Epub 2019 Apr 26.PMID:31034945.
Species: Rat
A00101-1 usage in article: APP:WB, SAMPLE:SGCS, DILUTION:1:1000

Ghoneim ME,Abdallah DM,Shebl AM,El-Abhar HS. The interrupted cross-talk of inflammatory and oxidative stress trajectories signifies the effect of artesunate against hepatic ischemia/reperfusion-induced inflammasomopathy. Toxicol Appl Pharmacol.2020 Oct 29
Species: Rat
A00101-1 usage in article: APP:WB, SAMPLE:PROTEIN EXTRACTIONS OF LIVER TISSUES, DILUTION:1:300

Exogenous %u03B1-calcitonin gene-related peptide attenuates lipopolysaccharide-induced acute lung injury in rats

In vivo anti-inflammatory activity of caffeoylquinic acid derivatives from Solidago virgaurea in rats

Effects of extract of Buddleja officinalis on partial inflammation of lacrimal gland in castrated rabbits with dry eye

miR-181a Induces Macrophage Polarized to M2 Phenotype and Promotes M2 Macrophage-mediated Tumor Cell Metastasis by Targeting KLF6 and C/EBP?

Antenatal exposure of maternal secondhand smoke (SHS) increases fetal lung expression of RAGE and induces RAGE-mediated pulmonary inflammation

NLRP3 Inflammasome Sequential Changes in?Staphylococcus aureus-Induced Mouse Model of Acute Rhinosinusitis

Neuroprotective Effect of Kaempferol Glycosides against Brain Injury and Neuroinflammation by Inhibiting the Activation of NF-?B and STAT3 in Transient Focal Stroke

Li C, Chen X, Zhang N, Song Y, Mu Y. Neural Regen Res. 2012 Feb 15;7(5):325-31. Doi: 10.3969/J.Issn.1673-5374.2012.05.001. Gastrodin Inhibits Neuroinflammation In Rotenone-Induced Parkinson'S Disease Model Rats.

Li J, Zhao L, He X, Zeng Yj, Dai Ss. Plos One. 2013;8(3):E59257. Doi: 10.1371/Journal.Pone.0059257. Epub 2013 Mar 15. Sinomenine Protects Against Lipopolysaccharide-Induced Acute Lung Injury In Mice Via Adenosine A(2A) Receptor Signaling.

Have you used Anti-IL1 beta/Il1b Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-IL1 beta/Il1b Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-IL1 beta/Il1b Antibody Picoband™

Question

Is a blocking peptide available for product anti-IL1 beta/Il1b antibody (A00101-1)?

Verified Customer

Verified customer

Asked: 2020-05-08

Answer

We do provide the blocking peptide for product anti-IL1 beta/Il1b antibody (A00101-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-05-08

Question

Is this A00101-1 anti-IL1 beta/Il1b antibody reactive to the isotypes of IL1B?

Verified Customer

Verified customer

Asked: 2020-03-02

Answer

The immunogen of A00101-1 anti-IL1 beta/Il1b antibody is A synthetic peptide corresponding to a sequence of mouse IL1 beta (DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-03-02

Question

We are currently using anti-IL1 beta/Il1b antibody A00101-1 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it possible that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2019-09-16

Answer

The anti-IL1 beta/Il1b antibody (A00101-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-16

Question

Can you help my question with product A00101-1, anti-IL1 beta/Il1b antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-07-15

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00101-1 anti-IL1 beta/Il1b antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-07-15

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for histiocytic lymphoma using anti-IL1 beta/Il1b antibody A00101-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-07-01

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-07-01

Question

I am interested in to test anti-IL1 beta/Il1b antibody A00101-1 on rat histiocytic lymphoma for research purposes, then I may be interested in using anti-IL1 beta/Il1b antibody A00101-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

L. Yang

Verified customer

Asked: 2019-03-29

Answer

The products we sell, including anti-IL1 beta/Il1b antibody A00101-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-03-29

Question

I was wanting to use your anti-IL1 beta/Il1b antibody for WB for rat histiocytic lymphoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat histiocytic lymphoma identification?

D. Johnson

Verified customer

Asked: 2017-11-03

Answer

As indicated on the product datasheet, A00101-1 anti-IL1 beta/Il1b antibody has been validated for WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat histiocytic lymphoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-11-03

Question

My team were satisfied with the WB result of your anti-IL1 beta/Il1b antibody. However we have been able to see positive staining in lung cytosol using this antibody. Is that expected? Could you tell me where is IL1B supposed to be expressed?

T. Walker

Verified customer

Asked: 2017-08-01

Answer

According to literature, lung does express IL1B. Generally IL1B expresses in cytoplasm, cytosol. Regarding which tissues have IL1B expression, here are a few articles citing expression in various tissues:
Histiocytic lymphoma, Pubmed ID: 3493774
Leukocyte, Pubmed ID: 3490654
Lung, Pubmed ID: 15489334
Macrophage, Pubmed ID: 20148899
Monocyte, Pubmed ID: 2635664, 11991722
Skin, Pubmed ID: 1919436

Boster Scientific Support

Answered: 2017-08-01

Question

Would anti-IL1 beta/Il1b antibody A00101-1 work for WB with histiocytic lymphoma?

G. Rodriguez

Verified customer

Asked: 2017-03-07

Answer

According to the expression profile of histiocytic lymphoma, IL1B is highly expressed in histiocytic lymphoma. So, it is likely that anti-IL1 beta/Il1b antibody A00101-1 will work for WB with histiocytic lymphoma.

Boster Scientific Support

Answered: 2017-03-07

Question

Would A00101-1 anti-IL1 beta/Il1b antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

A. Li

Verified customer

Asked: 2016-07-08

Answer

It shows on the product datasheet, A00101-1 anti-IL1 beta/Il1b antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2016-07-08

Question

We have seen staining in mouse monocyte. Any tips? Is anti-IL1 beta/Il1b antibody supposed to stain monocyte positively?

G. Kulkarni

Verified customer

Asked: 2014-09-15

Answer

From literature monocyte does express IL1B. From Uniprot.org, IL1B is expressed in smooth muscle tissue, leukocyte, histiocytic lymphoma, monocyte, lung, skin, macrophage, among other tissues. Regarding which tissues have IL1B expression, here are a few articles citing expression in various tissues:
Histiocytic lymphoma, Pubmed ID: 3493774
Leukocyte, Pubmed ID: 3490654
Lung, Pubmed ID: 15489334
Macrophage, Pubmed ID: 20148899
Monocyte, Pubmed ID: 2635664, 11991722
Skin, Pubmed ID: 1919436

Boster Scientific Support

Answered: 2014-09-15

Question

Do you have a BSA free version of anti-IL1 beta/Il1b antibody A00101-1 available?

S. Jones

Verified customer

Asked: 2014-09-09

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-IL1 beta/Il1b antibody A00101-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2014-09-09

Question

I see that the anti-IL1 beta/Il1b antibody A00101-1 works with WB, what is the protocol used to produce the result images on the product page?

D. Parker

Verified customer

Asked: 2013-06-10

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2013-06-10

Question

See below the WB image, lot number and protocol we used for histiocytic lymphoma using anti-IL1 beta/Il1b antibody A00101-1. Please let me know if you require anything else.

Z. Carter

Verified customer

Asked: 2013-02-12

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2013-02-12

Size

Conjugation

how to order through PO

Total: $315

Size:100ug

SKU:A00101-1

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!

ELISA Kits

ELISA Kits

More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.

Image

Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit

Reagents

Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
A00101-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.