Anti-MMP9 Antibody Picoband™

Boster Bio Anti-MMP9 Antibody Picoband™ catalog # PB10008. Tested in IHC, WB applications. This antibody reacts with Mouse, Rat. Cited in 44 publication(s).

Product Info Summary

SKU: PB10008
Size: 100μg/vial
Reactive Species: Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-MMP9 Antibody Picoband™

See all MMP-9 products

SKU/Catalog Number

PB10008

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-MMP9 Antibody Picoband™ catalog # PB10008. Tested in IHC, WB applications. This antibody reacts with Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MMP9 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10008)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of rat MMP-9 (622-658aa RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS), different from the related human sequence by nineteen amino acids, and from the related mouse sequence by nine amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB10008 is reactive to Mmp9 in Mouse, Rat

Applications

PB10008 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Rat

Validation Images & Assay Conditions

Gene/Protein Information For Mmp9 (Source: Uniprot.Org, NCBI)

Uniprot ID

P50282

Gene ID

81687

Gene Name

Mmp9

Full Name

Matrix metalloproteinase-9

Weight

78.611kDa

Superfamily

peptidase M10A family

Alternative Names

92 kDa gelatinase; 92 kDa type IV collagenase; CLG4B; EC 3.4.24; EC 3.4.24.35; Gelatinase B; GELB; macrophage gelatinase; MANDP2; matrix metallopeptidase 9; matrix metalloproteinase 9; matrix metalloproteinase-9; MMP9; MMP-9; type V collagenase Mmp9|matrix metallopeptidase 9|matrix metalloproteinase-9|92 kDa gelatinase|92-kDa type IV collagenase|GELB|MMP-9|gelatinase B|matrix metalloproteinase 9 (gelatinase B, 92-kDa type IV collagenase)

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on Mmp9, check out the Mmp9 Infographic

Mmp9 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for Mmp9: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

PB10008 has been cited in 44 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Kefeng Zhai, Hong Duan, Wei Wang, Siyu Zhao, Ghulam Jilany Khan, Mengting Wang, Yuhan Zhang, Kiran Thakur, Xuemei Fang, Chao Wu, Jianbo Xiao, Zhaojun Wei,Ginsenoside Rg1 ameliorates blood–brain barrier disruption and traumatic brain injury via attenuating macrophages derived exosomes miR-21 release, Acta Pharmaceutica Sinica B,2021,ISSN 2211 3835,https://doi.org/10. 1016/j.apsb.2021.03.032.
Species: Human,Rat
PB10008 usage in article: APP:IHC, SAMPLE:BRAIN TISSUE, DILUTION:NA

Integrated Transcriptomic and Proteomic Analyses of the Interaction Between Chicken Synovial Fibroblasts and Mycoplasma synoviae. X. Jian,Xiao Chunhong,C. Hongyan,Lu Huijun,Yu Haizhong,Y. Jianfen
Species: Human
PB10008 usage in article: APP:WB, SAMPLE:MCF-7 CELL, DILUTION:NA

Zhao HM,Jin L,Liu Y,Hong X.Changes in expressions of miR-22-3p and MMP-9 in rats with thoracic aortic aneurysm and their significance.Eur Rev Med Pharmacol Sci.2020 Jun;24(12):6949-6954.doi:10.26355/eurrev_202006_21686.PMID:32633388.
Species: Rat
PB10008 usage in article: APP:IHC, SAMPLE:HEART TISSUE, DILUTION:NA

Wang F,Ji S,Wang M,Liu L,Li Q,Jiang F,Cen J,Ji B.HMGB1 promoted P-glycoprotein at the blood-brain barrier in MCAO rats via TLR4/NF-κB signaling pathway.Eur J Pharmacol.2020 Aug 5;880:173189.doi:10.1016/j.ejphar.2020.173189.Epub 2020 May 15.PMID:32417325.
Species: Rat
PB10008 usage in article: APP:IHC, SAMPLE:BRAIN TISSUE, DILUTION:1:100

Liang Q,Lin Q,Li Y,Luo W,Huang X,Jiang Y,Qin C,Nong J,Chen X,Sooranna SR,Pinhu L.Effect of SIS3 on Extracellular Matrix Remodeling and Repair in a Lipopolysaccharide-Induced ARDS Rat Model.J Immunol Res.2020 Nov 25;2020:6644687.doi:10.1155/2020/6644687.PM
Species: Rat

1-calcium phosphate-uracil, a synthesized pyrimidine derivative agent, has anti-proliferative, pro-apoptotic and anti-invasion effects on multiple tumor cell lines

MgCl2 and ZnCl2 promote human umbilical vein endothelial cell migration and invasion and stimulate epithelial-mesenchymal transition via the Wnt/?-catenin pathway

Main components of pomegranate, ellagic acid and luteolin, inhibit metastasis of ovarian cancer by down-regulating MMP2 and MMP9

Early changes in the apparent diffusion coefficient and MMP-9 expression of a cervical carcinoma U14 allograft model following irradiation

Mesenchymal stem cells overexpressing adrenomedullin improve heart function through antifibrotic action in rats experiencing heart failure

Adipose differentiation-related protein knockdown inhibits vascular smooth muscle cell proliferation and migration and attenuates neointima formation

Hydrogen sulfide reduced renal tissue fibrosis by regulating autophagy in diabetic rats

Role of transforming growth factor ?-1 in the pathogenesis of pelvic organ prolapse: A potential therapeutic target

Suppression of A549 cell proliferation and metastasis by calycosin via inhibition of the PKC-?/ERK1/2 pathway: An in vitro investigation

Glycyrrhizic acid alleviates bleomycin-induced pulmonary fibrosis in rats

Chemokine CXCL12 and its receptor CXCR4 expression are associated with perineural invasion of prostate cancer

TGF-?1 promotes scar fibroblasts proliferation and transdifferentiation via up-regulating MicroRNA-21

Matrix metalloproteinase-9 and vascular endothelial growth factor expression change in experimental retinal neovascularization

Preventive Effects of Rhodiola rosea L on Bleomycin-Induced Pulmonary Fibrosis in Rats

Inhibition of acute lung injury by rubriflordilactone in LPS-induced rat model through suppression of inflammatory factor expression

MMP-1/2 and TIMP-1/2 expression levels, and the levels of collagenous and elastic fibers correlate with disease progression in a hamster model of tongue cancer

Argirein alleviates stress-induced and diabetic hypogonadism in rats via normalizing testis endothelin receptor A and connexin 43

Isolation and characteristics of CD133?/A2B5+ and CD133?/A2B5? cells from the SHG139s cell line

Amniotic Mesenchymal Stem Cells Can Enhance Angiogenic Capacity via MMPs In Vitro and In Vivo

Effect of Ginkgo biloba extract on experimental cardiac remodeling

Expression of matrix metalloproteinases-8 and -9 and their tissue inhibitor in the condyles of diabetic rats with mandibular advancement

Huoxue Rongluo?Tablet reduces matrix metalloproteinase-9 expression in infarcted brain tissue

Thalidomide influences growth and vasculogenic mimicry channel formation in melanoma

Zhang Y, Shen Y, Cao B, Yan A, Ji H. Exp Ther Med. 2015 Mar;9(3):905-908. Epub 2014 Dec 19. Elevated Expression Levels Of Androgen Receptors And Matrix Metalloproteinase-2 And -9 In 30 Cases Of Hepatocellular Carcinoma Compared With Adjacent Tissu...

Cheng Ys, Dai Dz, Dai Y. Acta Pharmacol Sin. 2009 Aug;30(8):1099-106. Doi: 10.1038/Aps.2009.104. Epub 2009 Jul 13. Isoproterenol Disperses Distribution Of Nadph Oxidase, Mmp-9, And Ppkcepsilon In The Heart, Which Are Mitigated By Endothelin Recept...

Yang Tq, Lu Xj, Wu Tf, Ding Dd, Zhao Zh, Chen Gl, Xie Xs, Li B, Wei Yx, Guo Lc, Zhang Y, Huang Yl, Zhou Yx, Du Zw. Cancer Sci. 2014 Mar;105(3):265-71. Doi: 10.1111/Cas.12351. Epub 2014 Feb 11. Microrna-16 Inhibits Glioma Cell Growth And Invasion T...

Li Xt, Wang Hz, Wu Zw, Yang Tq, Zhao Zh, Chen Gl, Xie Xs, Li B, Wei Yx, Huang Yl, Zhou Yx, Du Zw. Cell Mol Neurobiol. 2015 Jul;35(5):679-87. Doi: 10.1007/S10571-015-0163-0. Epub 2015 Feb 8. Mir-494-3P Regulates Cellular Proliferation, Invasion, Mi...

Song Y, Zou H, Wang G, Yang H, Xie Z, Bi J. Neural Regen Res. 2012 Jun 15;7(17):1325-30. Doi: 10.3969/J.Issn.1673-5374.2012.17.007. Matrix Metalloproteinase-9 And Tissue Inhibitor Of Metalloproteinase-1 Expression In Early Focal Cerebral Infarctio...

Wang J, Du Jr, Wang Y, Kuang X, Wang Cy. Acta Pharmacol Sin. 2010 Jul;31(7):791-7. Doi: 10.1038/Aps.2010.71. Epub 2010 Jun 28. Z-Ligustilide Attenuates Lipopolysaccharide-Induced Proinflammatory Response Via Inhibiting Nf-Kappab Pathway In Primary...

Liu J, Ping W, Zu Y, Sun W. Int J Clin Exp Pathol. 2014 Aug 15;7(9):6040-7. Ecollection 2014. Correlations Of Lysyl Oxidase With Mmp2/Mmp9 Expression And Its Prognostic Value In Non-Small Cell Lung Cancer.

Chen Lx, He Yj, Zhao Sz, Wu Jg, Wang Jt, Zhu Lm, Lin Tt, Sun Bc, Li Xr. Cancer Biol Ther. 2011 Jan 15;11(2):229-35. Epub 2011 Jan 15. Inhibition Of Tumor Growth And Vasculogenic Mimicry By Curcumin Through Down-Regulation Of The Epha2/Pi3K/Mmp Pat...

Liu Y, Zhou Y, Zhang Xs, Shen Bz. Oncol Lett. 2011 Nov;2(6):1171-1175. Epub 2011 Aug 17. Expression Of Vegf And Mmp-9 And Mri Imaging Changes In Cerebral Glioma.

Li Jk, Yu L, Shen Y, Zhou Ls, Wang Yc, Zhang Jh. World J Gastroenterol. 2008 Apr 21;14(15):2308-13. Inhibition Of Cxcr4 Activity With Amd3100 Decreases Invasion Of Human Colorectal Cancer Cells In Vitro.

Jiang S, Jin F, Li D, Zhang X, Yang Y, Yang D, Li K, Yang Y, Ma S. High Alt Med Biol. 2013 Jun;14(2):175-80. Doi: 10.1089/Ham.2012.1083. Intermittent Hypobaric Hypoxia Promotes Atherosclerotic Plaque Instability In Apoe-Deficient Mice.

Tang Y, Zhang X, Qi F, Chen M, Li Y, Liu L, He W, Li Z, Zu X. Exp Ther Med. 2015 May;9(5):1851-1856. Epub 2015 Feb 25. Afatinib Inhibits Proliferation And Invasion And Promotes Apoptosis Of The T24 Bladder Cancer Cell Line.

Tao L, Suhua C, Juanjuan C, Zongzhi Y, Juan X, Dandan Z. Virol J. 2011 Mar 11;8:114. Doi: 10.1186/1743-422X-8-114. In Vitro Study On Human Cytomegalovirus Affecting Early Pregnancy Villous Evt'S Invasion Function.

Zhou Ch, Wan Yy, Chu Xh, Song Z, Xing Sh, Wu Yq, Yin Xx. Oncol Lett. 2012 Dec;4(6):1259-1263. Epub 2012 Sep 21. Urotensin Ii Contributes To The Formation Of Lung Adenocarcinoma Inflammatory Microenvironment Through The Nf-??b Pathway In Tumor-Bear...

Ma X, Ma X, Ma Z, Sun Z, Yu W, Wang J, Li F, Ding J. Evid Based Complement Alternat Med. 2014;2014:710870. Doi: 10.1155/2014/710870. Epub 2014 Oct 15. The Effects Of Uygur Herb Hyssopus Officinalis L. On The Process Of Airway Remodeling In Asthmat...

Wang B, Liang S, Wang Y, Zhu Xq, Gong W, Zhang Hq, Li Y, Xia Cm. Plos Negl Trop Dis. 2015 Jan 15;9(1):E0003434. Doi: 10.1371/Journal.Pntd.0003434. Ecollection 2015. Th17 Down-Regulation Is Involved In Reduced Progression Of Schistosomiasis Fibrosi...

Have you used Anti-MMP9 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-MMP9 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

17 Customer Q&As for Anti-MMP9 Antibody Picoband™

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for umbilical cord blood using anti-MMP9 antibody PB10008. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-04-07

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-07

Question

Does anti-MMP9 antibody PB10008 work for WB with umbilical cord blood?

Verified Customer

Verified customer

Asked: 2020-01-10

Answer

According to the expression profile of umbilical cord blood, MMP9 is highly expressed in umbilical cord blood. So, it is likely that anti-MMP9 antibody PB10008 will work for WB with umbilical cord blood.

Boster Scientific Support

Answered: 2020-01-10

Question

Is a blocking peptide available for product anti-MMP9 antibody (PB10008)?

Verified Customer

Verified customer

Asked: 2019-11-25

Answer

We do provide the blocking peptide for product anti-MMP9 antibody (PB10008). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-11-25

Question

We are interested in using your anti-MMP9 antibody for cellular response to cell-matrix adhesion studies. Has this antibody been tested with western blotting on nrk whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-11-14

Answer

I appreciate your inquiry. This PB10008 anti-MMP9 antibody is validated on nrk whole cell lysates. It is guaranteed to work for IHC, WB in mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-11-14

Question

Is there a BSA free version of anti-MMP9 antibody PB10008 available?

Verified Customer

Verified customer

Asked: 2019-11-01

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-MMP9 antibody PB10008 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-11-01

Question

I see that the anti-MMP9 antibody PB10008 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-08-06

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-08-06

Question

Our lab were satisfied with the WB result of your anti-MMP9 antibody. However we have been able to see positive staining in blood extracellular using this antibody. Is that expected? Could you tell me where is MMP9 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-06-03

Answer

According to literature, blood does express MMP9. Generally MMP9 expresses in secreted, extracellular space, extracellular. Regarding which tissues have MMP9 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Blood, Pubmed ID: 1480034, 1281792
Fibrosarcoma, Pubmed ID: 1400481, 7669817
Monocytic leukemia, Pubmed ID: 20800577
Neutrophil, Pubmed ID: 1645657, 1464361, 1653055
Umbilical cord blood, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-06-03

Question

We ordered your anti-MMP9 antibody for IHC on blood in a previous project. I am using mouse, and We are going to use the antibody for WB next. Our lab want to know about examining blood as well as neutrophil in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2019-05-16

Answer

I took a look at the website and datasheets of our anti-MMP9 antibody and I see that PB10008 has been validated on mouse in both IHC and WB. Thus PB10008 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-05-16

Question

We are currently using anti-MMP9 antibody PB10008 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it true that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-01-07

Answer

The anti-MMP9 antibody (PB10008) has not been tested for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-01-07

Question

Is this PB10008 anti-MMP9 antibody reactive to the isotypes of MMP9?

Verified Customer

Verified customer

Asked: 2018-12-27

Answer

The immunogen of PB10008 anti-MMP9 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of rat MMP-9 (622-658aa RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS), different from the related human sequence by nineteen amino acids, and from the related mouse sequence by nine amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-12-27

Question

Just a question, MMP-9 and fibronectin are closely associated, so can product PB10008 distinguish between MMP-9 and fibronectin?

Verified Customer

Verified customer

Asked: 2018-12-25

Answer

Our product PB10008 antibody is specific to MMP-9, and will not cross-react with fibronectin. But remember that, MMP-9 binds to fibronectin and fibronectin co-elutes with MMP-9 in affinity chromatography procedures. Also in plasma and tissue culture MMP-9 can be found associated with fibronectin. It can be difficult to dissociate the complex.

Boster Scientific Support

Answered: 2018-12-25

Question

We want to test anti-MMP9 antibody PB10008 on rat umbilical cord blood for research purposes, then I may be interested in using anti-MMP9 antibody PB10008 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-05-16

Answer

The products we sell, including anti-MMP9 antibody PB10008, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-05-16

Question

Can you help my question with product PB10008, anti-MMP9 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-04-13

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10008 anti-MMP9 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-04-13

Question

I have attached the WB image, lot number and protocol we used for umbilical cord blood using anti-MMP9 antibody PB10008. Please let me know if you require anything else.

B. Krishna

Verified customer

Asked: 2017-07-13

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-07-13

Question

I was wanting to use your anti-MMP9 antibody for WB for rat umbilical cord blood on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat umbilical cord blood identification?

W. Huang

Verified customer

Asked: 2016-02-18

Answer

As indicated on the product datasheet, PB10008 anti-MMP9 antibody has been validated for IHC, WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat umbilical cord blood in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-02-18

Question

Will PB10008 anti-MMP9 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

C. Mangal

Verified customer

Asked: 2014-11-13

Answer

It shows on the product datasheet, PB10008 anti-MMP9 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2014-11-13

Question

We have seen staining in rat blood. Do you have any suggestions? Is anti-MMP9 antibody supposed to stain blood positively?

E. Parker

Verified customer

Asked: 2013-03-05

Answer

According to literature blood does express MMP9. According to Uniprot.org, MMP9 is expressed in tibia, umbilical cord blood, b-cell, neutrophil, fibrosarcoma, blood, monocytic leukemia, among other tissues. Regarding which tissues have MMP9 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Blood, Pubmed ID: 1480034, 1281792
Fibrosarcoma, Pubmed ID: 1400481, 7669817
Monocytic leukemia, Pubmed ID: 20800577
Neutrophil, Pubmed ID: 1645657, 1464361, 1653055
Umbilical cord blood, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2013-03-05

Conjugation

how to order through PO

Size

Total: $315

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB10008
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.