ASRGL1 (NM_025080) Human Recombinant Protein

Asrgl1 protein,

Product Info Summary

SKU: PROTQ7L266
Size: 20 µg
Source: HEK293T

Product Name

ASRGL1 (NM_025080) Human Recombinant Protein

View all Asrgl1 recombinant proteins

SKU/Catalog Number

PROTQ7L266

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human asparaginase like 1 (ASRGL1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ASRGL1 (NM_025080) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7L266)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.95kDa

Amino Acid Sequence

MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For Asrgl1 (Source: Uniprot.org, NCBI)

Gene Name

Asrgl1

Full Name

Isoaspartyl peptidase/L-asparaginase

Weight

33.95kDa

Superfamily

Ntn-hydrolase family

Alternative Names

ALP1; ALPL-asparagine amidohydrolase; asparaginase like 1; asparaginase-like 1 protein; Asparaginase-like protein 1; CRASH; EC 3.5.1.1; FLJ22316; L-asparaginase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Asrgl1, check out the Asrgl1 Infographic

Asrgl1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Asrgl1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ7L266

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ASRGL1 (NM_025080) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review ASRGL1 (NM_025080) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ASRGL1 (NM_025080) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ7L266
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.