Product Info Summary
SKU: | PROTO00175 |
---|---|
Size: | 5ug, 20ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
Eotaxin-2 Human Recombinant Protein (CCL24)
View all CCL24/Eotaxin-2/MPIF-2 recombinant proteins
SKU/Catalog Number
PROTO00175
Size
5ug, 20ug, 1mg
Description
CCL24 Human Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
Eotaxin-2 Human Recombinant Protein (CCL24) (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO00175)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.
Purity
Greater than 97.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Predicted MW
13.134kDa
Reconstitution
It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCG DPKQEWV QRYMKNLDAKQKKASPRARAVA
Biological Activity
The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For CCL24 (Source: Uniprot.org, NCBI)
Gene Name
CCL24
Full Name
C-C motif chemokine 24
Weight
13.134kDa
Superfamily
intercrine beta (chemokine CC) family
Alternative Names
CCL24; chemokine (C-C motif) ligand 24; Ckb-6; Eosinophil chemotactic protein 2; Eotaxin-2; member 24; MPIF2; MPIF-2; MPIF2Myeloid progenitor inhibitory factor 2; MPIF-2Small-inducible cytokine A24; SCYA24CK-beta-6 CCL24 Ckb-6, MPIF-2, MPIF2, SCYA24 C-C motif chemokine ligand 24 C-C motif chemokine 24|CK-beta-6|chemokine (C-C motif) ligand 24|eosinophil chemotactic protein 2|eotaxin-2|myeloid progenitor inhibitory factor 2|small inducible cytokine subfamily A (Cys-Cys), member 24|small-inducible cytokine A24
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CCL24, check out the CCL24 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CCL24: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Eotaxin-2 Human Recombinant Protein (CCL24) (PROTO00175)
Hello CJ!
No publications found for PROTO00175
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Eotaxin-2 Human Recombinant Protein (CCL24)?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Eotaxin-2 Human Recombinant Protein (CCL24)
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question