GADD45G (NM_006705) Human Recombinant Protein

GADD45G protein,

Product Info Summary

SKU: PROTO95257
Size: 20 µg
Source: HEK293T

Product Name

GADD45G (NM_006705) Human Recombinant Protein

View all GADD45G recombinant proteins

SKU/Catalog Number

PROTO95257

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human growth arrest and DNA-damage-inducible, gamma (GADD45G)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

GADD45G (NM_006705) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95257)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.121kDa

Amino Acid Sequence

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For GADD45G (Source: Uniprot.org, NCBI)

Gene Name

GADD45G

Full Name

Growth arrest and DNA damage-inducible protein GADD45 gamma

Weight

17.121kDa

Superfamily

GADD45 family

Alternative Names

CR6DNA damage-inducible transcript 2 protein; Cytokine-responsive protein CR6; DDIT-2; DDIT2GADD45-gamma; growth arrest and DNA damage-inducible protein GADD45 gamma; growth arrest and DNA-damage-inducible, gamma; GRP1717 kD GADD45G CR6, DDIT2, GADD45gamma, GRP17 growth arrest and DNA damage inducible gamma growth arrest and DNA damage-inducible protein GADD45 gamma|DDIT-2|DNA damage-inducible transcript 2 protein|GADD45-gamma|cytokine-responsive protein CR6|gadd-related protein, 17 kD

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GADD45G, check out the GADD45G Infographic

GADD45G infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GADD45G: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95257

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GADD45G (NM_006705) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review GADD45G (NM_006705) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GADD45G (NM_006705) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95257
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.