GALNT13 (NM_052917) Human Recombinant Protein

GALNT13 protein,

Recombinant protein of human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13)

Product Info Summary

SKU: PROTQ8IUC8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GALNT13 (NM_052917) Human Recombinant Protein

View all GALNT13 recombinant proteins

SKU/Catalog Number

PROTQ8IUC8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

GALNT13 (NM_052917) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IUC8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

64.051kDa

Amino Acid Sequence

MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGT

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For GALNT13 (Source: Uniprot.org, NCBI)

Gene Name

GALNT13

Full Name

Polypeptide N-acetylgalactosaminyltransferase 13

Weight

64.051kDa

Superfamily

glycosyltransferase 2 family

Alternative Names

Acetylgalactosaminyltransferase 13; EC 2.4.1.41; FLJ16031; FLJ41157; GalNAc transferase 13; GalNAc-T13; GalNAc-T13MGC119459; GALNT13; KIAA1918H_NH0187G20.1; MGC119461; Polypeptide GalNAc transferase 13; polypeptide N-acetylgalactosaminyltransferase 13; Pp-GaNTase 13; Protein-UDP acetylgalactosaminyltransferase 13; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13; UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 13 (GalNAc-T13); WUGSC:H_NH0187G20.1 GALNT13 GalNAc-T13 polypeptide N-acetylgalactosaminyltransferase 13 polypeptide N-acetylgalactosaminyltransferase 13|GalNAc transferase 13|UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13|UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13)|polypeptide GalNAc transferase 13|polypeptide N-acetylgalactosaminyltransferase 13 variant delta39bpEx9|polypeptide N-acetylgalactosaminyltransferase 13 variant deltaEx2-7|polypeptide N-acetylgalactosaminyltransferase 13 variant deltaEx6 delta39bpEx9|polypeptide N-acetylgalactosaminyltransferase 13 variant deltaEx6 deltaEx8 delta39bpEx9|polypeptide N-acetylgalactosaminyltransferase 13 variant deltaEx8|polypeptide N-acetylgalactosaminyltransferase 13 variant deltaEx9|pp-GaNTase 13|protein-UDP acetylgalactosaminyltransferase 13

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GALNT13, check out the GALNT13 Infographic

GALNT13 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GALNT13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8IUC8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GALNT13 (NM_052917) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review GALNT13 (NM_052917) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GALNT13 (NM_052917) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8IUC8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.