HP1 alpha (CBX5) (NM_001127321) Human Recombinant Protein

HP1 alpha protein,

Product Info Summary

SKU: PROTP45973
Size: 20 µg
Source: HEK293T

Product Name

HP1 alpha (CBX5) (NM_001127321) Human Recombinant Protein

View all HP1 alpha recombinant proteins

SKU/Catalog Number

PROTP45973

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromobox homolog 5 (HP1 alpha homolog, Drosophila) (CBX5), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

HP1 alpha (CBX5) (NM_001127321) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP45973)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.186kDa

Amino Acid Sequence

MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For Cbx5 (Source: Uniprot.org, NCBI)

Gene Name

Cbx5

Full Name

Chromobox protein homolog 5

Weight

22.186kDa

Alternative Names

Antigen p25; chromobox homolog 5 (Drosophila HP1 alpha); chromobox homolog 5 (HP1 alpha homolog, Drosophila); chromobox homolog 5; chromobox protein homolog 5; Heterochromatin protein 1 homolog alpha; heterochromatin protein 1-alpha; HP1 alpha homolog; HP1 alpha; HP1; HP1A; HP1-ALPHA; HP1Hs alpha; HP1Hs-alpha Cbx5|2610029O15Rik, C75991, HP, HP1, Hp1a, Hp1alpha|chromobox 5|chromobox protein homolog 5|HP1 alpha|chromobox homolog 5|heterochromatin protein 1 alpha|heterochromatin protein 1 homolog alpha|mHP1(alpha)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Cbx5, check out the Cbx5 Infographic

Cbx5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Cbx5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP45973

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HP1 alpha (CBX5) (NM_001127321) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review HP1 alpha (CBX5) (NM_001127321) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HP1 alpha (CBX5) (NM_001127321) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP45973
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.