AHSG Alpha-2-HS-Glycoprotein Human Recombinant Protein HEK

AHSG protein, Human

AHSG Human Recombinant produced by transfected human cells is a single polypeptide chain containing 357 amino acids (19-367). AHSG is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP02765
Size: 2ug, 10ug, 1mg
Origin Species: Human
Source: HEK293

Product Name

AHSG Alpha-2-HS-Glycoprotein Human Recombinant Protein HEK

View all AHSG recombinant proteins

SKU/Catalog Number

PROTP02765

Size

2ug, 10ug, 1mg

Description

AHSG Human Recombinant produced by transfected human cells is a single polypeptide chain containing 357 amino acids (19-367). AHSG is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized AHSG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution AHSG should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Cite This Product

AHSG Alpha-2-HS-Glycoprotein Human Recombinant Protein HEK (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP02765)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

AHSG was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, pH 7.5.

Purity

Greater than 95% as determined by SDS-PAGE.

Predicted MW

39.341kDa

Reconstitution

It is recommended to reconstitute the lyophilized AHSG in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIE IDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRK VCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTD CVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTP VVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSH PRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconstitution

It is recommended to reconstitute the lyophilized AHSG in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For AHSG (Source: Uniprot.org, NCBI)

Gene Name

AHSG

Full Name

Alpha-2-HS-glycoprotein

Weight

39.341kDa

Superfamily

fetuin family

Alternative Names

A2HS; AHS; AHSG; alpha-2-HS-glycoprotein; alpha-2-Z-globulin; Ba-alpha-2-glycoprotein; FETUAba-alpha-2-glycoprotein; Fetuin A; fetuin-A; HSGA AHSG A2HS, AHS, APMR1, FETUA, HSGA alpha 2-HS glycoprotein alpha-2-HS-glycoprotein|alpha-2-Z-globulin|ba-alpha-2-glycoprotein|fetuin-A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on AHSG, check out the AHSG Infographic

AHSG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AHSG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP02765

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used AHSG Alpha-2-HS-Glycoprotein Human Recombinant Protein HEK?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review AHSG Alpha-2-HS-Glycoprotein Human Recombinant Protein HEK

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for AHSG Alpha-2-HS-Glycoprotein Human Recombinant Protein HEK

Size

Total: $250

SKU:PROTP02765

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
Eddy test
In stock
Order Product
PROTP02765
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.