Product Info Summary
SKU: | PROTP02765 |
---|---|
Size: | 2ug, 10ug, 1mg |
Origin Species: | Human |
Source: | HEK293 |
Customers Who Bought This Also Bought
Product info
Product Name
AHSG Alpha-2-HS-Glycoprotein Human Recombinant Protein HEK
View all AHSG recombinant proteins
SKU/Catalog Number
PROTP02765
Size
2ug, 10ug, 1mg
Description
AHSG Human Recombinant produced by transfected human cells is a single polypeptide chain containing 357 amino acids (19-367). AHSG is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized AHSG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution AHSG should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Cite This Product
AHSG Alpha-2-HS-Glycoprotein Human Recombinant Protein HEK (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP02765)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
AHSG was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, pH 7.5.
Purity
Greater than 95% as determined by SDS-PAGE.
Predicted MW
39.341kDa
Reconstitution
It is recommended to reconstitute the lyophilized AHSG in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIE IDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRK VCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTD CVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTP VVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSH PRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized AHSG in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.
Protein Target Info & Infographic
Gene/Protein Information For AHSG (Source: Uniprot.org, NCBI)
Gene Name
AHSG
Full Name
Alpha-2-HS-glycoprotein
Weight
39.341kDa
Superfamily
fetuin family
Alternative Names
A2HS; AHS; AHSG; alpha-2-HS-glycoprotein; alpha-2-Z-globulin; Ba-alpha-2-glycoprotein; FETUAba-alpha-2-glycoprotein; Fetuin A; fetuin-A; HSGA AHSG A2HS, AHS, APMR1, FETUA, HSGA alpha 2-HS glycoprotein alpha-2-HS-glycoprotein|alpha-2-Z-globulin|ba-alpha-2-glycoprotein|fetuin-A
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on AHSG, check out the AHSG Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for AHSG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For AHSG Alpha-2-HS-Glycoprotein Human Recombinant Protein HEK (PROTP02765)
Hello CJ!
No publications found for PROTP02765
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used AHSG Alpha-2-HS-Glycoprotein Human Recombinant Protein HEK?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For AHSG Alpha-2-HS-Glycoprotein Human Recombinant Protein HEK
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question