Anti-Galactosidase alpha/Gla Antibody Picoband™

alpha-Galactosidase A/GLA antibody

Boster Bio Anti-Galactosidase alpha/Gla Antibody Picoband™ catalog # A01135. Tested in WB applications. This antibody reacts with Mouse, Rat.

Product Info Summary

SKU: A01135
Size: 100 μg/vial
Reactive Species: Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Galactosidase alpha/Gla Antibody Picoband™

View all alpha-Galactosidase A/GLA Antibodies

SKU/Catalog Number

A01135

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Galactosidase alpha/Gla Antibody Picoband™ catalog # A01135. Tested in WB applications. This antibody reacts with Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Galactosidase alpha/Gla Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01135)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla, different from the related human sequence by fifteen amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01135 is reactive to GLA in Mouse, Rat

Applications

A01135 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

49 kDa

Calculated molecular weight

48.767kDa

Background of alpha-Galactosidase A/GLA

Alpha-galactosidase is a glycoside hydrolase enzyme that encoded by the GLA gene. This gene is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For GLA (Source: Uniprot.org, NCBI)

Gene Name

GLA

Full Name

Alpha-galactosidase A

Weight

48.767kDa

Superfamily

glycosyl hydrolase 27 family

Alternative Names

agalsidase alfa; Agalsidase alpha; Agalsidase; Alpha-D-galactosidase A; alpha-D-galactoside galactohydrolase 1; Alpha-D-galactoside galactohydrolase; alpha-gal A; alpha-galactosidase A; EC 3.2.1; EC 3.2.1.22; GALA; galactosidase, alpha; GLA; Melibiase GLA GALA galactosidase alpha alpha-galactosidase A|agalsidase alfa|alpha-D-galactosidase A|alpha-D-galactoside galactohydrolase 1|alpha-gal A|galactosylgalactosylglucosylceramidase GLA|melibiase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on GLA, check out the GLA Infographic

GLA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GLA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A01135

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Galactosidase alpha/Gla Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-Galactosidase alpha/Gla Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-Galactosidase alpha/Gla Antibody Picoband™

Question

Is this A01135 anti-Galactosidase alpha/Gla antibody reactive to the isotypes of GLA?

Verified Customer

Verified customer

Asked: 2019-07-26

Answer

The immunogen of A01135 anti-Galactosidase alpha/Gla antibody is A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-07-26

Question

Does anti-Galactosidase alpha/Gla antibody A01135 work on dog WB with left adrenal gland?

Verified Customer

Verified customer

Asked: 2019-06-10

Answer

Our lab technicians have not tested anti-Galactosidase alpha/Gla antibody A01135 on dog. You can run a BLAST between dog and the immunogen sequence of anti-Galactosidase alpha/Gla antibody A01135 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated dog samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in dog left adrenal gland in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-06-10

Question

Will A01135 anti-Galactosidase alpha/Gla antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-02-12

Answer

As indicated on the product datasheet, A01135 anti-Galactosidase alpha/Gla antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-02-12

Question

We are currently using anti-Galactosidase alpha/Gla antibody A01135 for mouse tissue, and we are content with the WB results. The species of reactivity given in the datasheet says mouse. Is it true that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2018-01-05

Answer

The anti-Galactosidase alpha/Gla antibody (A01135) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-01-05

Question

I see that the anti-Galactosidase alpha/Gla antibody A01135 works with WB, what is the protocol used to produce the result images on the product page?

B. Carter

Verified customer

Asked: 2017-10-31

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-10-31

Order DetailsPrice
A01135

100μg

$370
A01135-10ug

10μg sample (liquid)

$99
A01135-Biotin

100 μg Biotin conjugated

$570
A01135-Cy3

100 μg Cy3 conjugated

$570
A01135-Dylight488

100 μg Dylight488 conjugated

$570
A01135-Dylight550

100 μg Dylight550 conjugated

$570
A01135-Dylight594

100 μg Dylight594 conjugated

$570
A01135-FITC

100 μg FITC conjugated

$570
A01135-HRP

100 μg HRP conjugated

$570
A01135-APC

100 μg APC conjugated

$670
A01135-PE

100 μg PE conjugated

$670
A01135-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01135
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.