Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10)

Emerin antibody

Boster Bio Anti-Human Emerin DyLight® 550 conjugated EMD Antibody (monoclonal, 5A10) catalog # M00714-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Product Info Summary

SKU: M00714-Dyl550
Size: 100 μg/vial
Reactive Species: Human
Host: Mouse
Application: Flow Cytometry

Product Name

Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10)

View all Emerin Antibodies

SKU/Catalog Number

M00714-Dyl550

Size

100 μg/vial

Form

Liquid

Description

Boster Bio Anti-Human Emerin DyLight® 550 conjugated EMD Antibody (monoclonal, 5A10) catalog # M00714-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Storage & Handling

At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.

Cite This Product

Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00714-Dyl550)

Host

Mouse

Contents

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Clonality

Monoclonal

Clone Number

5A10

Isotype

Mouse IgG1

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin, different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

M00714-Dyl550 is reactive to EMD in Human

Reconstitution

Observed Molecular Weight

39 kDa

Calculated molecular weight

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

M00714-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Flow Cytometry (Fixed), 1-3μg/1x106 cells

Positive Control

Validation Images & Assay Conditions

Gene/Protein Information For EMD (Source: Uniprot.org, NCBI)

Gene Name

EMD

Full Name

Emerin

Weight

Alternative Names

emerin; Emery-Dreifuss muscular dystrophy; LEM domain containing 5; STAEDMDLEMD5 EMD EDMD, LEMD5, STA emerin emerin|LEM domain containing 5

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on EMD, check out the EMD Infographic

EMD infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EMD: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for M00714-Dyl550

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10)?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10)

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10)

Question

We are currently using anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 for human tissue, and we are content with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on horse tissues as well?

P. Williams

Verified customer

Asked: 2020-03-18

Answer

The anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) (M00714-Dyl550) has not been tested for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-18

Question

Is there a BSA free version of anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 available?

Verified Customer

Verified customer

Asked: 2020-02-28

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-02-28

Question

Is a blocking peptide available for product anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) (M00714-Dyl550)?

J. Brown

Verified customer

Asked: 2020-01-14

Answer

We do provide the blocking peptide for product anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) (M00714-Dyl550). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-01-14

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-01-08

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-08

Question

Would anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 work on monkey Flow Cytometry with cervix carcinoma erythroleukemia?

Verified Customer

Verified customer

Asked: 2019-09-05

Answer

Our lab technicians have not tested anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 on monkey. You can run a BLAST between monkey and the immunogen sequence of anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated monkey samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in monkey cervix carcinoma erythroleukemia in Flow Cytometry, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-09-05

Question

Is this M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) reactive to the isotypes of EMD?

Verified Customer

Verified customer

Asked: 2019-08-28

Answer

The immunogen of M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) is A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-28

Question

I see that the anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-07-10

Answer

You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-07-10

Question

My colleagues were content with the WB result of your anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10). However we have observed positive staining in platelet nucleus inner membrane using this antibody. Is that expected? Could you tell me where is EMD supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-06-04

Answer

According to literature, platelet does express EMD. Generally EMD expresses in nucleus inner membrane. Regarding which tissues have EMD expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 18691976, 20068231
Cervix carcinoma, and Embryonic kidney, Pubmed ID: 9673989
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 15489334
Platelet, Pubmed ID: 12665801
Teratocarcinoma, Pubmed ID: 7894480

Boster Scientific Support

Answered: 2019-06-04

Question

Please see the WB image, lot number and protocol we used for placenta using anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-05-28

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-05-28

Question

Does M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-04-08

Answer

As indicated on the product datasheet, M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) as been tested on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-04-08

Question

Does anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 work for Flow Cytometry with placenta?

Verified Customer

Verified customer

Asked: 2019-03-08

Answer

According to the expression profile of placenta, EMD is highly expressed in placenta. So, it is likely that anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 will work for Flow Cytometry with placenta.

Boster Scientific Support

Answered: 2019-03-08

Question

We have seen staining in human leukemic t-cell. Are there any suggestions? Is anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) supposed to stain leukemic t-cell positively?

Verified Customer

Verified customer

Asked: 2018-02-15

Answer

From literature leukemic t-cell does express EMD. From Uniprot.org, EMD is expressed in esophagogastric junction muscularis propria, teratocarcinoma, placenta, platelet, cervix carcinoma embryonic kidney, leukemic t-cell, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have EMD expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 18691976, 20068231
Cervix carcinoma, and Embryonic kidney, Pubmed ID: 9673989
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 15489334
Platelet, Pubmed ID: 12665801
Teratocarcinoma, Pubmed ID: 7894480

Boster Scientific Support

Answered: 2018-02-15

Question

I was wanting to use your anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) for Flow Cytometry for human placenta on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human placenta identification?

K. Wu

Verified customer

Asked: 2017-07-20

Answer

You can see on the product datasheet, M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) has been validated for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human placenta in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-07-20

Question

Can you help my question with product M00714-Dyl550, anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10). I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2017-06-30

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10), we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2017-06-30

Question

Our lab want to know about to test anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 on human placenta for research purposes, then I may be interested in using anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

T. Rodriguez

Verified customer

Asked: 2015-04-01

Answer

The products we sell, including anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2015-04-01

Order DetailsPrice
M00714-Dyl550

100μg

$515
M00714-Dyl550-carrier-free

Carrier Free

$515

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
M00714-Dyl550
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$515.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.