Anti-Human SUR1 DyLight® 550 conjugated ABCC8 Antibody

SUR1 antibody

Boster Bio Anti-Human SUR1 DyLight® 550 conjugated ABCC8 Antibody catalog # A00895-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Product Info Summary

SKU: A00895-Dyl550
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry

Product Name

Anti-Human SUR1 DyLight® 550 conjugated ABCC8 Antibody

View all SUR1 Antibodies

SKU/Catalog Number

A00895-Dyl550

Size

100 μg/vial

Form

Liquid

Description

Boster Bio Anti-Human SUR1 DyLight® 550 conjugated ABCC8 Antibody catalog # A00895-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Storage & Handling

At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.

Cite This Product

Anti-Human SUR1 DyLight® 550 conjugated ABCC8 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00895-Dyl550)

Host

Rabbit

Contents

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human SUR1, which shares 97.7% amino acid (aa) sequence identity with both mouse and rat SUR1.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00895-Dyl550 is reactive to ABCC8 in Human

Applications

A00895-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee

Observed Molecular Weight

39 kDa

Calculated molecular weight

176.992kDa

Background of SUR1

ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For ABCC8 (Source: Uniprot.org, NCBI)

Gene Name

ABCC8

Full Name

ATP-binding cassette sub-family C member 8

Weight

176.992kDa

Superfamily

ABC transporter superfamily

Alternative Names

ABC36; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; HHF1Sulfonylurea receptor 1; HI; PHHIHRINS; sulfonylurea receptor (hyperinsulinemia); SUR1MRP8; SURATP-binding cassette transporter sub-family C member 8; TNDM2ATP-binding cassette sub-family C member 8 ABCC8 ABC36, HHF1, HI, HRINS, MRP8, PHHI, PNDM3, SUR, SUR1, SUR1delta2, TNDM2 ATP binding cassette subfamily C member 8 ATP-binding cassette sub-family C member 8|ATP-binding cassette transporter sub-family C member 8|ATP-binding cassette, sub-family C (CFTR/MRP), member 8|sulfonylurea receptor (hyperinsulinemia)|sulfonylurea receptor 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ABCC8, check out the ABCC8 Infographic

ABCC8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ABCC8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00895-Dyl550

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Human SUR1 DyLight® 550 conjugated ABCC8 Antibody?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-Human SUR1 DyLight® 550 conjugated ABCC8 Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-Human SUR1 DyLight® 550 conjugated ABCC8 Antibody

Question

I am looking for to test anti-Human SUR1 DyLight® 550 conjugated antibody A00895-Dyl550 on human brain foreskin for research purposes, then I may be interested in using anti-Human SUR1 DyLight® 550 conjugated antibody A00895-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-03-26

Answer

The products we sell, including anti-Human SUR1 DyLight® 550 conjugated antibody A00895-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-03-26

Question

We are currently using anti-Human SUR1 DyLight® 550 conjugated antibody A00895-Dyl550 for human tissue, and we are well pleased with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-29

Answer

The anti-Human SUR1 DyLight® 550 conjugated antibody (A00895-Dyl550) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-29

Question

I have a question about product A00895-Dyl550, anti-Human SUR1 DyLight® 550 conjugated antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-01-21

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00895-Dyl550 anti-Human SUR1 DyLight® 550 conjugated antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-01-21

Question

Is this A00895-Dyl550 anti-Human SUR1 DyLight® 550 conjugated antibody reactive to the isotypes of ABCC8?

Verified Customer

Verified customer

Asked: 2019-05-22

Answer

The immunogen of A00895-Dyl550 anti-Human SUR1 DyLight® 550 conjugated antibody is A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-05-22

Order DetailsPrice
A00895-Dyl550

100μg

$515
A00895-Dyl550-carrier-free

Carrier Free

$515

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00895-Dyl550
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$515.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.