Anti-LIMK1 Antibody Picoband™

LIMK1 antibody

Boster Bio Anti-LIMK1 Antibody Picoband™ catalog # PB9716. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 2 publication(s).

Product Info Summary

SKU: PB9716
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-LIMK1 Antibody Picoband™

View all LIMK1 Antibodies

SKU/Catalog Number

PB9716

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-LIMK1 Antibody Picoband™ catalog # PB9716. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-LIMK1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9716)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9716 is reactive to LIMK1 in Human, Mouse, Rat

Applications

PB9716 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

72 kDa

Calculated molecular weight

72.585kDa

Background of LIMK1

LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For LIMK1 (Source: Uniprot.org, NCBI)

Gene Name

LIMK1

Full Name

LIM domain kinase 1

Weight

72.585kDa

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.11.1; LIM domain kinase 1; LIM motif-containing protein kinase; LIMKLIMK-1 LIMK1 LIMK, LIMK-1 LIM domain kinase 1 LIM domain kinase 1|LIM motif-containing protein kinase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on LIMK1, check out the LIMK1 Infographic

LIMK1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LIMK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9716 has been cited in 2 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Han F,Xu H,Shen JX,Pan C,Yu ZH,Chen JJ,Zhu XL,Cai YF,Lu YP.RhoA/Rock2/Limk1/cofilin1 pathway is involved in attenuation of neuronal dendritic spine loss by paeonol in the frontal cortex of D-galactose and aluminum‑induced Alzheimer‘s disease‑like ra
Species: Rat
PB9716 usage in article: APP:WB, SAMPLE:BRAIN TISSUE, DILUTION:1:300

Zhang W, Gan N, Zhou J. J Int Med Res. 2012;40(3):1067-73. Immunohistochemical Investigation Of The Correlation Between Lim Kinase 1 Expression And Development And Progression Of Human Ovarian Carcinoma.

Have you used Anti-LIMK1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-LIMK1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-LIMK1 Antibody Picoband™

Question

Is there a BSA free version of anti-LIMK1 antibody PB9716 available?

Verified Customer

Verified customer

Asked: 2020-02-28

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-LIMK1 antibody PB9716 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-02-28

Question

We are currently using anti-LIMK1 antibody PB9716 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-30

Answer

The anti-LIMK1 antibody (PB9716) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-30

Question

Does PB9716 anti-LIMK1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-07-11

Answer

You can see on the product datasheet, PB9716 anti-LIMK1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-07-11

Question

I have attached the WB image, lot number and protocol we used for hippocampus placenta using anti-LIMK1 antibody PB9716. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-05-15

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-05-15

Question

Is this PB9716 anti-LIMK1 antibody reactive to the isotypes of LIMK1?

Verified Customer

Verified customer

Asked: 2019-01-22

Answer

The immunogen of PB9716 anti-LIMK1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 (599-634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-01-22

Order DetailsPrice
PB9716

100μg

$370
PB9716-10ug

10μg sample (liquid)

$99
PB9716-Biotin

100 μg Biotin conjugated

$570
PB9716-Cy3

100 μg Cy3 conjugated

$570
PB9716-Dylight488

100 μg Dylight488 conjugated

$570
PB9716-Dylight550

100 μg Dylight550 conjugated

$570
PB9716-Dylight594

100 μg Dylight594 conjugated

$570
PB9716-FITC

100 μg FITC conjugated

$570
PB9716-HRP

100 μg HRP conjugated

$570
PB9716-APC

100 μg APC conjugated

$670
PB9716-PE

100 μg PE conjugated

$670
PB9716-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9716
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.