Product Info Summary
SKU: | A33995 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | ELISA |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SARS-CoV-2 ORF8 Antibody
SKU/Catalog Number
A33995
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SARS-CoV-2 ORF8 Antibody catalog # A33995. Tested in ELISA applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SARS-CoV-2 ORF8 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A33995)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Clonality
Polyclonal
Clone Number
IC-16
Isotype
Rabbit IgG
Immunogen
AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Reactive Species
A33995 is reactive to in Human
Applications
A33995 is guaranteed for ELISA Boster Guarantee
Observed Molecular Weight
140 kDa, 130 kDa, 110 kDa
Calculated molecular weight
16693 MW
Background of
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF8 encodes a viral accessory protein.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
ELISA, 0.001-0.1μg/ml, Human
Validation Images & Assay Conditions
There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.
Specific Publications For Anti-SARS-CoV-2 ORF8 Antibody (A33995)
Hello CJ!
No publications found for A33995
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SARS-CoV-2 ORF8 Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-SARS-CoV-2 ORF8 Antibody
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question