ARMER (ARL6IP1) (NM_015161) Human Recombinant Protein

ARMER protein,

Recombinant protein of human ADP-ribosylation factor-like 6 interacting protein 1 (ARL6IP1)

Product Info Summary

SKU: PROTQ15041
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ARMER (ARL6IP1) (NM_015161) Human Recombinant Protein

View all ARMER recombinant proteins

SKU/Catalog Number

PROTQ15041

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ADP-ribosylation factor-like 6 interacting protein 1 (ARL6IP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ARMER (ARL6IP1) (NM_015161) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15041)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.363kDa

Amino Acid Sequence

MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For ARL6IP1 (Source: Uniprot.org, NCBI)

Gene Name

ARL6IP1

Full Name

ADP-ribosylation factor-like protein 6-interacting protein 1

Weight

23.363kDa

Superfamily

ARL6ip family

Alternative Names

ADP-ribosylation factor-like 6 interacting protein 1; ADP-ribosylation factor-like 6 interacting protein; AIP1; Aip-1; apoptotic regulator in the membrane of the endoplasmic reticulum; ARL-6-interacting protein 1; ARL6IPaip-1; ARMER; KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1 ARL6IP1 AIP1, ARL6IP, ARMER, SPG61 ADP ribosylation factor like GTPase 6 interacting protein 1 ADP-ribosylation factor-like protein 6-interacting protein 1|ADP-ribosylation factor GTPase 6 interacting protein 1|ADP-ribosylation factor-like 6 interacting protein 1|ARL-6-interacting protein 1|aip-1|apoptotic regulator in the membrane of the endoplasmic reticulum

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ARL6IP1, check out the ARL6IP1 Infographic

ARL6IP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ARL6IP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15041

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ARMER (ARL6IP1) (NM_015161) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review ARMER (ARL6IP1) (NM_015161) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ARMER (ARL6IP1) (NM_015161) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15041
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.