CRHBP (NM_001882) Human Recombinant Protein

CRHBP protein,

Product Info Summary

SKU: PROTP24387
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CRHBP (NM_001882) Human Recombinant Protein

View all CRHBP recombinant proteins

SKU/Catalog Number

PROTP24387

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human corticotropin releasing hormone binding protein (CRHBP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

CRHBP (NM_001882) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP24387)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.144kDa

Amino Acid Sequence

MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For CRHBP (Source: Uniprot.org, NCBI)

Gene Name

CRHBP

Full Name

Corticotropin-releasing factor-binding protein

Weight

36.144kDa

Superfamily

CRF-binding protein family

Alternative Names

corticotropin releasing hormone binding protein; corticotropin-releasing factor-binding protein; Corticotropin-releasing hormone-binding protein; CRFBP; CRFBPcorticotropin releasing hormone-binding protein; CRF-BPCRF-binding protein; CRHBP; CRH-BP CRHBP CRF-BP, CRFBP corticotropin releasing hormone binding protein corticotropin-releasing factor-binding protein|CRF-binding protein|CRH-BP

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CRHBP, check out the CRHBP Infographic

CRHBP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRHBP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP24387

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CRHBP (NM_001882) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review CRHBP (NM_001882) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CRHBP (NM_001882) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP24387
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.