HSD3B2 (NM_000198) Human Recombinant Protein

Beta Hydroxysteroid Dehydrogenase protein,

Recombinant protein of human hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 (HSD3B2)

Product Info Summary

SKU: PROTP26439
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HSD3B2 (NM_000198) Human Recombinant Protein

View all Beta Hydroxysteroid Dehydrogenase recombinant proteins

SKU/Catalog Number

PROTP26439

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 (HSD3B2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

HSD3B2 (NM_000198) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP26439)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

42.052kDa

Amino Acid Sequence

MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For HSD3B2 (Source: Uniprot.org, NCBI)

Gene Name

HSD3B2

Full Name

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2

Weight

42.052kDa

Superfamily

3-beta-HSD family

Alternative Names

3 beta-HSD type II; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3-beta-HSD II; delta 5-delta 4-isomerase type II; HSD3B; HSDB; HSDB3B; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2,3-beta-hydroxy-Delta(5)-steroid dehydrogenase; progesterone reductase; SDR11E2; short chain dehydrogenase/reductase family 11E, member 2,3-beta-hydroxy-5-ene steroid dehydrogenase HSD3B2 HSD3B, HSDB, SDR11E2 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2|3 beta-HSD type II|3 beta-hydroxysteroid dehydrogenase type II, delta 5-delta 4-isomerase type II, 3 beta-HSD type II|3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II|3-beta-HSD II|3-beta-HSD adrenal and gonadal type|3-beta-hydroxy-5-ene steroid dehydrogenase|3-beta-hydroxy-Delta(5)-steroid dehydrogenase|delta 5-delta 4-isomerase type II|progesterone reductase|short chain dehydrogenase/reductase family 11E, member 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HSD3B2, check out the HSD3B2 Infographic

HSD3B2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HSD3B2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP26439

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HSD3B2 (NM_000198) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review HSD3B2 (NM_000198) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HSD3B2 (NM_000198) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP26439
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.