Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF

CCL4 protein, Human

C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1β (MIP-1β), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells and epithelial cells. CCL4 recruits various immune cells like natural killer cells, monocytes, and neutrophils when CCL4 binds to CCR5. In addition, CCL4 mediates lymphocyte adhesion by Rac1 /Cdc42 signaling pathway and plays critical roles in different biological functions like maintenance of cell polarity, regulation of calcium ion transport and response to viruses.

Product Info Summary

SKU: PROTP13236-2
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture
Designing a Western blot for CCL4? The guide covers the expected band size, antibodies backed by real blot images, the controls to run alongside, and protocols taken from published papers.
Open the CCL4 Western Blot Guide

Product Name

Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF

View all CCL4 recombinant proteins

SKU/Catalog Number

PROTP13236-2

Size

5ug,20ug,100ug

Tag

Tag Free

Description

C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1β (MIP-1β), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells and epithelial cells. CCL4 recruits various immune cells like natural killer cells, monocytes, and neutrophils when CCL4 binds to CCR5. In addition, CCL4 mediates lymphocyte adhesion by Rac1 /Cdc42 signaling pathway and plays critical roles in different biological functions like maintenance of cell polarity, regulation of calcium ion transport and response to viruses.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP13236-2)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

10.2 kDa

Molecular weight

The protein has a calculated MW of 7.75 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED₅₀ for this effect is <10 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

APMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF

Size

Total: $77.00

SKU:PROTP13236-2

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP13236-2
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 18, 2026