Click image to see more details
Product Info Summary
| SKU: | PROTP18510-5 |
|---|---|
| Size: | 20ug,100ug,500ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF
View all IL1RN recombinant proteins
SKU/Catalog Number
PROTP18510-5
Size
20ug,100ug,500ug
Tag
His Tag (C-term)
Description
Interleukin 1 receptor antagonist (IL-1RA) is a 17.26 kDa member of IL-1 family with 153 amino acid residues. IL-1RA is expressed by peripheral blood cells, lungs, spleen, liver and is secreted from monocytes, macrophages, neutrophils, and other cells. Inhibits the activity of interleukin-1 by binding to receptor IL1R1. IL-1RA can modulate a variety of interleukin-1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP18510-5)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
20.1 kDa
Molecular weight
The protein has a calculated MW of 18.07 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to inhibit IL-1 alpha -dependent proliferation in D10.G4.1 cells. The ED₅₀ for this effect is <50 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IL-1RA
Specific Publications For Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF (PROTP18510-5)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
