Product Info Summary
| SKU: | PROTQ9HBE4-6 |
|---|---|
| Size: | 100ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture, ELISA |
Product info
Product Name
Human recombinant IL-21 protein, GMP
View all IL21 recombinant proteins
SKU/Catalog Number
PROTQ9HBE4-6
Size
100ug,1mg
Tag
His Tag (C-term)
Description
Interleukin-21 (IL-21) belongs to the IL-15/IL-21 family, which exerts pleiotropic immune regulations. IL-21 produced primarily by natural killer T (NKT) cells, T follicular helper (TFH) cells and TH17 cells. As a pleiotropic cytokine, IL-21 has been shown to regulate both innate and humoral immunity. It has potent inhibitory activity towards the activation and maturation of granulocyte-macrophage colony-stimulating factor (GM-CSF)-induced dendritic cells (DCs). In B cells, IL-21 has a major role in the development of immunoglobulin responses. In T cells, it is required to facilitate the functional differentiation of several CD4+ T cell subsets. In addition, the ability of IL-21 to enhance the cytotoxic activity of both CD8+ T cells and NK cells makes it as a potential antitumor agent.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-21 protein, GMP (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HBE4-6)
Form
Lyophilized
Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.
Purity
>95% as determined by SDS-PAGE analysis.
Predicted MW
18.7 kDa
Molecular weight
The protein has a calculated MW of 16.2 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED₅₀ for this effect is <10 ng/mL.
Endotoxin
<0.05 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of GMP human IL-21
Specific Publications For Human recombinant IL-21 protein, GMP (PROTQ9HBE4-6)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-21 protein, GMP?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-21 protein, GMP
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
