Product Info Summary
SKU: | PROTQ9NZH6 |
---|---|
Size: | 3x2ug, 25ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
IL37 Interleukin-37 Human Recombinant Protein
View all IL-37/IL-1F7 recombinant proteins
SKU/Catalog Number
PROTQ9NZH6
Size
3x2ug, 25ug, 1mg
Description
Interleukin-37 Human Recombinant produced in E. coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa. The IL37 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Cite This Product
IL37 Interleukin-37 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NZH6)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
IL37 was lyophilized from a 0.2μM filtered solution of 20mM PB, 150mM NaCl and 2mM DTT pH 7.4.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Predicted MW
24.126kDa
Reconstitution
It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYR
Biological Activity
As measured by its binding ability in a functional ELISA, immobilized IL1F7 at 1 µg/ml (100 µl/well) can bind rhIL-18 R/Fc Chimera with a linear range of 0.015-1µg/ml.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconstitution
It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For IL37 (Source: Uniprot.org, NCBI)
Gene Name
IL37
Full Name
Interleukin-37
Weight
24.126kDa
Superfamily
IL-1 family
Alternative Names
FIL1 zeta; FIL1; FIL1(ZETA); FIL1ZFIL1 zeta; IL-1F7; IL-1F7IL-1 zeta; IL1H4IL1F7 (canonical product IL-1F7b); IL-1H4IL-1F7b (IL-1H4, IL-1H, IL-1RP1); IL-1RP1IL-1X protein; IL1RP1interleukin 1 family member 7; IL-1X; IL37; IL-37; interleukin 1 family, member 7 (zeta); interleukin 1, zeta; interleukin-1 family member 7; Interleukin-1 homolog 4; interleukin-1 superfamily z; Interleukin-1 zeta; Interleukin-1-related protein IL37 FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H, IL-1H4, IL-1RP1, IL-23, IL-37, IL1F7, IL1H4, IL1RP1 interleukin 37 interleukin-37|FIL1 zeta|IL-1 zeta|IL-1F7b (IL-1H4, IL-1H, IL-1RP1)|IL-1X protein|IL1F7 (canonical product IL-1F7b)|interleukin 1 family member 7|interleukin 1, zeta|interleukin-1 homolog 4|interleukin-1 superfamily z|interleukin-1-related protein|interleukin-23
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL37, check out the IL37 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL37: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For IL37 Interleukin-37 Human Recombinant Protein (PROTQ9NZH6)
Hello CJ!
No publications found for PROTQ9NZH6
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used IL37 Interleukin-37 Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review IL37 Interleukin-37 Human Recombinant Protein
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question