Mouse recombinant LIF protein, AF

LIF protein, Mouse

Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein, belonging to the IL-6 receptor family. Mouse LIF shares 79% sequence homology with human LIF. LIF is a 19.7 kDa protein containing 202 amino acid which high expression in human liver, bone, uterus, kidney and the central nervous system. LIF is a inducer of differentiation in M1 leukaemia cells, osteoblasts and glia. Not only stimulates proliferation of DA1 cells inhibit proliferation of corticotrophs and promote cell survival in some cell types but also induces apoptosis in others.

Product Info Summary

SKU: PROTP09056-1
Size: 5ug,20ug,100ug
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant LIF protein, AF

View all LIF recombinant proteins

SKU/Catalog Number

PROTP09056-1

Size

5ug,20ug,100ug

Tag

His Tag (N-term)

Description

Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein, belonging to the IL-6 receptor family. Mouse LIF shares 79% sequence homology with human LIF. LIF is a 19.7 kDa protein containing 202 amino acid which high expression in human liver, bone, uterus, kidney and the central nervous system. LIF is a inducer of differentiation in M1 leukaemia cells, osteoblasts and glia. Not only stimulates proliferation of DA1 cells inhibit proliferation of corticotrophs and promote cell survival in some cell types but also induces apoptosis in others.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant LIF protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09056-1)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>95% as determined by SDS-PAGE.

Predicted MW

22.3 kDa

Molecular weight

The protein has a calculated MW of 20.68 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce IL-6 secretion in M1 cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant mouse LIF is > 2 x 10⁶ IU/mg.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Mouse recombinant LIF protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant LIF protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant LIF protein, AF

Size

Total: $77

SKU:PROTP09056-1

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP09056-1
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Apr 12, 2026