Click image to see more details
Product Info Summary
| SKU: | PROTP27169 |
|---|---|
| Size: | 2ug, 10ug, 1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
PON1 Paraoxonase-1 Human Recombinant Protein
View all PON1 recombinant proteins
SKU/Catalog Number
PROTP27169
Size
2ug, 10ug, 1mg
Description
Paraoxonase-1 Isoform Human Recombinant is expressed in E. coli, fused to a 4.5kDa amino terminal hexahistidine tag, having a total molecular weight of 42.9kDa. The PON1 purified by proprietary chromatographic techniques.
Storage & Handling
Store at 4°C if entire vial will be used within 1-2 weeks. Store frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.
Cite This Product
PON1 Paraoxonase-1 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP27169)
Form
Sterile Filtered clear solution.
Formulation
PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
Purity
Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Predicted MW
39.731kDa
Amino Acid Sequence
MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIE TGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLE LGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQE EEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWEM YLGLAWSYVVYYSPSEVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHV YEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYD SENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGT VFHKALYCELZ
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For PON1 (Source: Uniprot.org, NCBI)
Gene Name
PON1
Full Name
Serum paraoxonase/arylesterase 1
Weight
39.731kDa
Superfamily
paraoxonase family
Alternative Names
A-esterase 1; Aromatic esterase 1; arylesterase B-type; EC 3.1.1.2; EC 3.1.1.81; EC 3.1.8.1; ESA; ESAesterase A; K-45; MVCD5; paraoxonase 1; PON 1; PON1; PONparaoxonase B-type; serum aryldiakylphosphatase; Serum aryldialkylphosphatase 1; serum paraoxonase/arylesterase 1 PON1 ESA, MVCD5, PON paraoxonase 1 serum paraoxonase/arylesterase 1|A-esterase 1|K-45|PON 1|aromatic esterase 1|arylesterase 1|arylesterase B-type|esterase A|paraoxonase B-type|serum aryldiakylphosphatase|serum aryldialkylphosphatase 1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on PON1, check out the PON1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PON1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For PON1 Paraoxonase-1 Human Recombinant Protein (PROTP27169)
Hello CJ!
No publications found for PROTP27169
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used PON1 Paraoxonase-1 Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review PON1 Paraoxonase-1 Human Recombinant Protein
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
1 Customer Q&As for PON1 Paraoxonase-1 Human Recombinant Protein
Question
Is PROTP27169 protein form biologically active and capable of hydrolysing organophosphate pesticides?
Verified customer
Asked: 2019-07-11
Answer
Our lab have not assessed the bio-functionality of the PON1 Paraoxonase-1 Human Recombinant Protein PROTP27169 to date. So, we cannot guarantee that the protein is biologically active.
Boster Scientific Support
Answered: 2019-07-11
