PSMA3 (NM_002788) Human Recombinant Protein

Proteasome 20S alpha 3 protein,

Product Info Summary

SKU: PROTP25788
Size: 20 µg
Source: HEK293T

Product Name

PSMA3 (NM_002788) Human Recombinant Protein

View all Proteasome 20S alpha 3 recombinant proteins

SKU/Catalog Number

PROTP25788

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 3 (PSMA3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

PSMA3 (NM_002788) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP25788)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.433kDa

Amino Acid Sequence

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADMAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Validation Images & Assay Conditions

Gene/Protein Information For PSMA3 (Source: Uniprot.org, NCBI)

Gene Name

PSMA3

Full Name

Proteasome subunit alpha type-3

Weight

28.433kDa

Superfamily

peptidase T1A family

Alternative Names

EC 3.4.25.1; HC8MGC32631; Macropain subunit C8; MGC12306; Multicatalytic endopeptidase complex subunit C8; proteasome (prosome, macropain) subunit, alpha type, 3; Proteasome component C8; proteasome subunit alpha type-3; proteasome subunit C8; PSC3; PSC8 PSMA3 HC8, PSC3 proteasome 20S subunit alpha 3 proteasome subunit alpha type-3|macropain subunit C8|multicatalytic endopeptidase complex subunit C8|proteasome (prosome, macropain) subunit, alpha type, 3|proteasome component C8|proteasome subunit C8|proteasome subunit alpha 3|proteasome subunit alpha7|testicular secretory protein Li 43

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PSMA3, check out the PSMA3 Infographic

PSMA3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PSMA3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP25788

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PSMA3 (NM_002788) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PSMA3 (NM_002788) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PSMA3 (NM_002788) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP25788
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.