RIT2 (NM_002930) Human Recombinant Protein

RIT2 protein,

Recombinant protein of human Ras-like without CAAX 2 (RIT2)

Product Info Summary

SKU: PROTQ99578
Size: 20 µg
Source: HEK293T

Product Name

RIT2 (NM_002930) Human Recombinant Protein

View all RIT2 recombinant proteins

SKU/Catalog Number

PROTQ99578

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Ras-like without CAAX 2 (RIT2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

RIT2 (NM_002930) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99578)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.668kDa

Amino Acid Sequence

MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLKKKRENMT

Validation Images & Assay Conditions

Gene/Protein Information For RIT2 (Source: Uniprot.org, NCBI)

Gene Name

RIT2

Full Name

GTP-binding protein Rit2

Weight

24.668kDa

Superfamily

small GTPase superfamily

Alternative Names

GTP-binding protein Rit2; GTP-binding protein Roc2; Ras-like protein expressed in neurons; Ras-like without CAAX 2; Ras-like without CAAX protein 2; RIBA; Ric (Drosophila)-like, expressed in neurons; Ric-like, expressed in neurons; RIN; Rit2; ROC2 RIT2 RIBA, RIN, ROC2 Ras like without CAAX 2 GTP-binding protein Rit2|GTP-binding protein Roc2|Ric-like, expressed in neurons|ras-like protein expressed in neurons|ras-like without CAAX protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RIT2, check out the RIT2 Infographic

RIT2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RIT2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99578

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RIT2 (NM_002930) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RIT2 (NM_002930) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RIT2 (NM_002930) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99578
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.