S100A11 (NM_005620) Human Recombinant Protein

S100A11 protein,

Product Info Summary

SKU: PROTP31949
Size: 20 µg
Source: HEK293T

Product Name

S100A11 (NM_005620) Human Recombinant Protein

View all S100A11 recombinant proteins

SKU/Catalog Number

PROTP31949

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human S100 calcium binding protein A11 (S100A11)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

S100A11 (NM_005620) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP31949)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.74kDa

Amino Acid Sequence

MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For S100A11 (Source: Uniprot.org, NCBI)

Gene Name

S100A11

Full Name

Protein S100-A11

Weight

11.74kDa

Superfamily

S-100 family

Alternative Names

Calgizzarin; Metastatic lymph node gene 70 protein; MLN 70; MLN70; protein S100-A11; Protein S100-C; S100 calcium binding protein A11; S100 calcium-binding protein A11 (calgizzarin); S100 calcium-binding protein A11; S100A11; S100C; S100CS100 calcium binding protein A11 (calgizzarin) S100A11 HEL-S-43, MLN70, S100C S100 calcium binding protein A11 protein S100-A11|MLN 70|calgizzarin|epididymis secretory protein Li 43|metastatic lymph node gene 70 protein|protein S100-C

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on S100A11, check out the S100A11 Infographic

S100A11 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for S100A11: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP31949

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used S100A11 (NM_005620) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review S100A11 (NM_005620) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for S100A11 (NM_005620) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP31949
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.